BLASTX nr result
ID: Panax21_contig00018542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018542 (622 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 tpg|DAA46621.1| TPA: ATP binding protein [Zea mays] 72 1e-10 tpg|DAA46620.1| TPA: hypothetical protein ZEAMMB73_163376 [Zea m... 72 1e-10 gb|ACN27302.1| unknown [Zea mays] 72 1e-10 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/55 (56%), Positives = 47/55 (85%) Frame = +2 Query: 2 LLPESLYKRISSIGDPSISVVPVLDQWVQKGREIRKQELQDIIRELKNYKQFKHA 166 ++ ++LY+RIS +GDP+ISV P+LDQWV +GR +++ EL+ II+EL+ YK+FKHA Sbjct: 26 VVKDNLYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHA 80 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/55 (56%), Positives = 47/55 (85%) Frame = +2 Query: 2 LLPESLYKRISSIGDPSISVVPVLDQWVQKGREIRKQELQDIIRELKNYKQFKHA 166 ++ ++LY+RIS +GDP+ISV P+LDQWV +GR +++ EL+ II+EL+ YK+FKHA Sbjct: 26 VVKDNLYRRISPVGDPNISVTPLLDQWVLEGRLVQQDELRHIIKELRVYKRFKHA 80 >tpg|DAA46621.1| TPA: ATP binding protein [Zea mays] Length = 308 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 312 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 434 +S VC ALSCLLDFY VRHLIKVE+RPNLILNAEKELGIV Sbjct: 76 SSAIVCAALSCLLDFYNVRHLIKVEMRPNLILNAEKELGIV 116 >tpg|DAA46620.1| TPA: hypothetical protein ZEAMMB73_163376 [Zea mays] Length = 175 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 312 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 434 +S VC ALSCLLDFY VRHLIKVE+RPNLILNAEKELGIV Sbjct: 76 SSAIVCAALSCLLDFYNVRHLIKVEMRPNLILNAEKELGIV 116 >gb|ACN27302.1| unknown [Zea mays] Length = 362 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 312 NSPEVCPALSCLLDFYKVRHLIKVEVRPNLILNAEKELGIV 434 +S VC ALSCLLDFY VRHLIKVE+RPNLILNAEKELGIV Sbjct: 130 SSAIVCAALSCLLDFYNVRHLIKVEMRPNLILNAEKELGIV 170