BLASTX nr result
ID: Panax21_contig00018532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018532 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270990.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_003553289.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 ref|XP_003524728.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 ref|XP_002298561.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_002526972.1| pentatricopeptide repeat-containing protein,... 72 6e-11 >ref|XP_002270990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial [Vitis vinifera] gi|296087577|emb|CBI34833.3| unnamed protein product [Vitis vinifera] Length = 445 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 375 YAIVRDMTAAGLGLNKFCYAGLIAAHRNKTPLMDDTAAKV 256 YAIVRDMTAAGLGLNKFCYAGLIAAH+NK PL DDTA+K+ Sbjct: 166 YAIVRDMTAAGLGLNKFCYAGLIAAHKNKIPLTDDTASKI 205 >ref|XP_003553289.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Glycine max] Length = 450 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 375 YAIVRDMTAAGLGLNKFCYAGLIAAHRNKTPLMDDTAAKV 256 YAIVRDMTAAGLGLN+FCYAGLI AH+NKTPL DD AAKV Sbjct: 170 YAIVRDMTAAGLGLNEFCYAGLIVAHKNKTPLPDDFAAKV 209 >ref|XP_003524728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial-like [Glycine max] Length = 450 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 375 YAIVRDMTAAGLGLNKFCYAGLIAAHRNKTPLMDDTAAKV 256 YAIVRDMTAAGLGLN+FCYAGLI AH+NK PL DD AAKV Sbjct: 170 YAIVRDMTAAGLGLNEFCYAGLIVAHKNKKPLPDDFAAKV 209 >ref|XP_002298561.1| predicted protein [Populus trichocarpa] gi|222845819|gb|EEE83366.1| predicted protein [Populus trichocarpa] Length = 300 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -2 Query: 375 YAIVRDMTAAGLGLNKFCYAGLIAAHRNKTPLMDDTAAKV 256 YAIVRDMT+AG+GLNKFCYAGLIAAH+NKTP+ +D A K+ Sbjct: 162 YAIVRDMTSAGVGLNKFCYAGLIAAHKNKTPIAEDVATKI 201 >ref|XP_002526972.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533724|gb|EEF35459.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 510 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 375 YAIVRDMTAAGLGLNKFCYAGLIAAHRNKTPLMDDTAAKV 256 YAIVRDMTAAG GLNKFCYAGLIAAH NK PL DDTA ++ Sbjct: 208 YAIVRDMTAAGAGLNKFCYAGLIAAHMNKKPLSDDTAKRI 247