BLASTX nr result
ID: Panax21_contig00018487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018487 (1061 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281134.1| PREDICTED: mitochondrial substrate carrier f... 72 2e-10 ref|XP_002512372.1| peroxisomal membrane protein pmp34, putative... 71 5e-10 gb|ABR67418.1| mitochondrial FAD carrier [Cucumis melo subsp. melo] 71 5e-10 ref|XP_002328561.1| predicted protein [Populus trichocarpa] gi|2... 70 7e-10 ref|XP_004139184.1| PREDICTED: peroxisomal membrane protein PMP3... 69 2e-09 >ref|XP_002281134.1| PREDICTED: mitochondrial substrate carrier family protein Q [Vitis vinifera] gi|297737006|emb|CBI26207.3| unnamed protein product [Vitis vinifera] Length = 319 Score = 72.4 bits (176), Expect = 2e-10 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 1061 DAQILKTVLSSALLLMIKEKITKSTWVLLLAIRRSLFVTRTRLKSS 924 +AQILKTVLSSALLLMIKEKITK+TWV+LLA+RR L V RTRLK++ Sbjct: 274 EAQILKTVLSSALLLMIKEKITKTTWVILLALRRYLTVNRTRLKAA 319 >ref|XP_002512372.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] gi|223548333|gb|EEF49824.1| peroxisomal membrane protein pmp34, putative [Ricinus communis] Length = 318 Score = 70.9 bits (172), Expect = 5e-10 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 1058 AQILKTVLSSALLLMIKEKITKSTWVLLLAIRRSLFVTRTRLKSS 924 AQILKTVLSSALLLMIKEKI++STWVL+LAIRR L V R+RLKS+ Sbjct: 274 AQILKTVLSSALLLMIKEKISRSTWVLILAIRRYLLVPRSRLKSA 318 >gb|ABR67418.1| mitochondrial FAD carrier [Cucumis melo subsp. melo] Length = 317 Score = 70.9 bits (172), Expect = 5e-10 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 1058 AQILKTVLSSALLLMIKEKITKSTWVLLLAIRRSLFVTRTRLKSS 924 AQILKTVLSSALLLMIKEKIT +TWVL+LAIRR L +TR +LKSS Sbjct: 273 AQILKTVLSSALLLMIKEKITSTTWVLILAIRRYLLLTRPKLKSS 317 >ref|XP_002328561.1| predicted protein [Populus trichocarpa] gi|222838276|gb|EEE76641.1| predicted protein [Populus trichocarpa] Length = 317 Score = 70.5 bits (171), Expect = 7e-10 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 1058 AQILKTVLSSALLLMIKEKITKSTWVLLLAIRRSLFVTRTRLKSS 924 AQILKTVLSSALLLMIKEKI +TWVL+LAIRR LF+TR RLKS+ Sbjct: 273 AQILKTVLSSALLLMIKEKIAATTWVLILAIRRYLFLTRGRLKST 317 >ref|XP_004139184.1| PREDICTED: peroxisomal membrane protein PMP34-like [Cucumis sativus] gi|449482864|ref|XP_004156426.1| PREDICTED: peroxisomal membrane protein PMP34-like [Cucumis sativus] Length = 317 Score = 68.9 bits (167), Expect = 2e-09 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -1 Query: 1058 AQILKTVLSSALLLMIKEKITKSTWVLLLAIRRSLFVTRTRLKSS 924 AQILKTVLSSALLLMIKEKIT +TWVL+LA RR L +TR +LKSS Sbjct: 273 AQILKTVLSSALLLMIKEKITSTTWVLILAARRYLLLTRPKLKSS 317