BLASTX nr result
ID: Panax21_contig00018244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018244 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|2... 59 9e-07 >ref|XP_002306011.1| predicted protein [Populus trichocarpa] gi|222848975|gb|EEE86522.1| predicted protein [Populus trichocarpa] Length = 462 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = -1 Query: 617 FTDDYWAQIREQTI--GYDLGVFNMEDKSIQSFYQCD-LGTEPPPLWVDP 477 FTDDYW ++ E + G+D+GVFN++DKS++ FYQ D L +PPP W P Sbjct: 410 FTDDYWERMNEDYLYGGHDMGVFNLKDKSVKHFYQLDALKIQPPPCWFLP 459