BLASTX nr result
ID: Panax21_contig00018103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018103 (923 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001190586.1| leucine-rich repeat-containing protein [Arab... 59 2e-06 >ref|NP_001190586.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332010058|gb|AED97441.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Length = 339 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -2 Query: 775 INQILDTSVLFTCRDLHNNKLTGPIPPQIGRLRRLKILYNPYFKAIDIFL 626 + +LD + L DLHNNKLTGPIPPQIGRL+RLK+LY+P +++ L Sbjct: 93 VTNLLDLTRL----DLHNNKLTGPIPPQIGRLKRLKVLYDPILFRVNLAL 138