BLASTX nr result
ID: Panax21_contig00018090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018090 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279794.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER [... 84 1e-14 ref|XP_002531910.1| protein binding protein, putative [Ricinus c... 79 5e-13 ref|XP_003542854.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 76 2e-12 ref|XP_003540530.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-l... 76 2e-12 gb|ACU23155.1| unknown [Glycine max] 76 2e-12 >ref|XP_002279794.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Vitis vinifera] gi|297736239|emb|CBI24877.3| unnamed protein product [Vitis vinifera] Length = 247 Score = 84.0 bits (206), Expect = 1e-14 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +2 Query: 2 QIKLPCKHVYHTECGSKWLSINKTCPICNTEVFGEESRH 118 QIKLPCKHVYHT+CG+KWL+INK CP+CN EVFGEESRH Sbjct: 209 QIKLPCKHVYHTDCGTKWLTINKVCPVCNIEVFGEESRH 247 >ref|XP_002531910.1| protein binding protein, putative [Ricinus communis] gi|223528450|gb|EEF30483.1| protein binding protein, putative [Ricinus communis] Length = 240 Score = 78.6 bits (192), Expect = 5e-13 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 QIKLPCKHVYHTECGSKWLSINKTCPICNTEVFGEESRH 118 Q+KLPCKHVYH+EC SKWL INK CP+CN EVFGE+SRH Sbjct: 202 QMKLPCKHVYHSECISKWLGINKVCPVCNNEVFGEDSRH 240 >ref|XP_003542854.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Glycine max] Length = 247 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 QIKLPCKHVYHTECGSKWLSINKTCPICNTEVFGEESRH 118 Q+KLPC HVYH EC +KWLSINK CP+CNTEVFGEES H Sbjct: 209 QMKLPCSHVYHGECITKWLSINKKCPVCNTEVFGEESTH 247 >ref|XP_003540530.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Glycine max] Length = 247 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 QIKLPCKHVYHTECGSKWLSINKTCPICNTEVFGEESRH 118 Q+KLPC HVYH EC +KWLSINK CP+CNTEVFGEES H Sbjct: 209 QMKLPCSHVYHGECITKWLSINKKCPVCNTEVFGEESTH 247 >gb|ACU23155.1| unknown [Glycine max] Length = 247 Score = 76.3 bits (186), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 QIKLPCKHVYHTECGSKWLSINKTCPICNTEVFGEESRH 118 Q+KLPC HVYH EC +KWLSINK CP+CNTEVFGEES H Sbjct: 209 QMKLPCSHVYHGECITKWLSINKKCPVCNTEVFGEESTH 247