BLASTX nr result
ID: Panax21_contig00017987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017987 (571 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530270.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_002264923.1| PREDICTED: uncharacterized protein LOC100257... 76 3e-12 emb|CBI29465.3| unnamed protein product [Vitis vinifera] 76 3e-12 dbj|BAH19891.1| AT5G64170 [Arabidopsis thaliana] 69 5e-10 ref|NP_001078793.1| dentin sialophosphoprotein-like protein [Ara... 69 5e-10 >ref|XP_002530270.1| conserved hypothetical protein [Ricinus communis] gi|223530202|gb|EEF32110.1| conserved hypothetical protein [Ricinus communis] Length = 641 Score = 77.0 bits (188), Expect = 2e-12 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 12/79 (15%) Frame = +3 Query: 24 VTEGT-KCSGYMDIETDTNPIDRSIAHLLFHRPS----------MSLKSHSMIPRSTTGS 170 +TE T K +G++DIETDTNPIDRSIAHLLFHRPS +SLKSH+M+ S T Sbjct: 554 ITEDTNKGTGFLDIETDTNPIDRSIAHLLFHRPSDPSLIPLNDALSLKSHTMVHGSITSP 613 Query: 171 PMII-EKLCHEESDSETDR 224 P+I +++C EES S D+ Sbjct: 614 PVISKDQICQEESASGADK 632 >ref|XP_002264923.1| PREDICTED: uncharacterized protein LOC100257088 [Vitis vinifera] Length = 688 Score = 76.3 bits (186), Expect = 3e-12 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 10/87 (11%) Frame = +3 Query: 3 DKDARTFVTEGTKCSGYMDIETDTNPIDRSIAHLLFHRPS---------MSLKSHSMIPR 155 D E KC+G+MD+ETDTNPIDRSIAHLLFHRPS +SLKS +M+ Sbjct: 597 DTGGLLMAAEPNKCTGFMDMETDTNPIDRSIAHLLFHRPSDPSIVPNDALSLKSQNMMQG 656 Query: 156 STTGSPMIIEKLCH-EESDSETDRKVS 233 S T P++ EKL EE+ +D+ V+ Sbjct: 657 SITSPPVVAEKLVSLEENAVGSDKNVA 683 >emb|CBI29465.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 76.3 bits (186), Expect = 3e-12 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 10/87 (11%) Frame = +3 Query: 3 DKDARTFVTEGTKCSGYMDIETDTNPIDRSIAHLLFHRPS---------MSLKSHSMIPR 155 D E KC+G+MD+ETDTNPIDRSIAHLLFHRPS +SLKS +M+ Sbjct: 59 DTGGLLMAAEPNKCTGFMDMETDTNPIDRSIAHLLFHRPSDPSIVPNDALSLKSQNMMQG 118 Query: 156 STTGSPMIIEKLCH-EESDSETDRKVS 233 S T P++ EKL EE+ +D+ V+ Sbjct: 119 SITSPPVVAEKLVSLEENAVGSDKNVA 145 >dbj|BAH19891.1| AT5G64170 [Arabidopsis thaliana] Length = 616 Score = 68.9 bits (167), Expect = 5e-10 Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 10/63 (15%) Frame = +3 Query: 30 EGTKCSGYMDIETDTNPIDRSIAHLLFHRPS----------MSLKSHSMIPRSTTGSPMI 179 E K +G+MDIETDTNPIDRSIAHLLFHRPS +S KSH MIP+ + + Sbjct: 535 EADKYAGFMDIETDTNPIDRSIAHLLFHRPSDSSLSSDNNVLSYKSHPMIPQPNSSPSLR 594 Query: 180 IEK 188 IEK Sbjct: 595 IEK 597 >ref|NP_001078793.1| dentin sialophosphoprotein-like protein [Arabidopsis thaliana] gi|332010467|gb|AED97850.1| dentin sialophosphoprotein-like protein [Arabidopsis thaliana] Length = 616 Score = 68.9 bits (167), Expect = 5e-10 Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 10/63 (15%) Frame = +3 Query: 30 EGTKCSGYMDIETDTNPIDRSIAHLLFHRPS----------MSLKSHSMIPRSTTGSPMI 179 E K +G+MDIETDTNPIDRSIAHLLFHRPS +S KSH MIP+ + + Sbjct: 535 EADKYAGFMDIETDTNPIDRSIAHLLFHRPSDSSLSSDNNVLSYKSHPMIPQPNSSPSLR 594 Query: 180 IEK 188 IEK Sbjct: 595 IEK 597