BLASTX nr result
ID: Panax21_contig00017797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017797 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permea... 66 3e-09 emb|CBI16645.3| unnamed protein product [Vitis vinifera] 66 3e-09 emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] 66 3e-09 ref|XP_002511602.1| cationic amino acid transporter, putative [R... 65 8e-09 ref|XP_003534469.1| PREDICTED: uncharacterized amino acid permea... 62 6e-08 >ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permease YhdG-like [Vitis vinifera] Length = 574 Score = 66.2 bits (160), Expect = 3e-09 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -2 Query: 335 STFGHLF*TNGIEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 171 S GH G E + GALS NILAPILLVLLT+ILCRGVGESS +N MTV+KV Sbjct: 175 SWIGH----GGEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMTVTKV 225 >emb|CBI16645.3| unnamed protein product [Vitis vinifera] Length = 600 Score = 66.2 bits (160), Expect = 3e-09 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -2 Query: 335 STFGHLF*TNGIEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 171 S GH G E + GALS NILAPILLVLLT+ILCRGVGESS +N MTV+KV Sbjct: 201 SWIGH----GGEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMTVTKV 251 >emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] Length = 623 Score = 66.2 bits (160), Expect = 3e-09 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -2 Query: 335 STFGHLF*TNGIEEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 171 S GH G E + GALS NILAPILLVLLT+ILCRGVGESS +N MTV+KV Sbjct: 201 SWIGH----GGEEFLGGALSINILAPILLVLLTIILCRGVGESSAVNCFMTVTKV 251 >ref|XP_002511602.1| cationic amino acid transporter, putative [Ricinus communis] gi|223548782|gb|EEF50271.1| cationic amino acid transporter, putative [Ricinus communis] Length = 568 Score = 64.7 bits (156), Expect = 8e-09 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -2 Query: 308 NGIEEMFGA-LSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 171 +G +E FG LS NILAPILL LLTV+LC GVGESSILNS MTV+KV Sbjct: 174 HGGQEFFGGTLSINILAPILLALLTVVLCWGVGESSILNSFMTVTKV 220 >ref|XP_003534469.1| PREDICTED: uncharacterized amino acid permease YhdG-like [Glycine max] Length = 558 Score = 62.0 bits (149), Expect = 6e-08 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 299 EEMFGALSFNILAPILLVLLTVILCRGVGESSILNSLMTVSKV 171 E++ LS N+LAPILLVLLT ILCRGV ESS++NSLMTV+KV Sbjct: 172 EDIGDVLSINVLAPILLVLLTFILCRGVQESSVVNSLMTVTKV 214