BLASTX nr result
ID: Panax21_contig00017506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017506 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604589.1| Aberrant root formation protein [Medicago tr... 60 2e-07 ref|XP_002282976.2| PREDICTED: aberrant root formation protein 4... 56 3e-06 emb|CBI21098.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_003604589.1| Aberrant root formation protein [Medicago truncatula] gi|355505644|gb|AES86786.1| Aberrant root formation protein [Medicago truncatula] Length = 179 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 152 EESTSVLVDFLNTISDSVVTDPKNEEFENTAFEILSEIHTYLSSPSLDQE 3 E + S LV+FL+++ D+ +DP NE EN AFE LSEIH Y+ SPSLDQE Sbjct: 41 ENTFSELVNFLDSLLDAAFSDPYNEHKENDAFEALSEIHRYICSPSLDQE 90 >ref|XP_002282976.2| PREDICTED: aberrant root formation protein 4-like [Vitis vinifera] Length = 668 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 158 QSEESTSVLVDFLNTISDSVVTDPKNEEFENTAFEILSEIHTYLSSPSLDQ 6 +S S S LV++L++ISD+ ++D NEE N A E+LSEIH Y+ P LDQ Sbjct: 38 KSGSSVSELVNYLDSISDAALSDTSNEESRNNALEVLSEIHLYICQPLLDQ 88 >emb|CBI21098.3| unnamed protein product [Vitis vinifera] Length = 606 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 158 QSEESTSVLVDFLNTISDSVVTDPKNEEFENTAFEILSEIHTYLSSPSLDQ 6 +S S S LV++L++ISD+ ++D NEE N A E+LSEIH Y+ P LDQ Sbjct: 38 KSGSSVSELVNYLDSISDAALSDTSNEESRNNALEVLSEIHLYICQPLLDQ 88