BLASTX nr result
ID: Panax21_contig00017481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017481 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519358.1| leucine-rich repeat-containing protein, puta... 70 2e-10 ref|XP_002512273.1| leucine-rich repeat-containing protein, puta... 58 8e-07 >ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223541425|gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1108 Score = 70.1 bits (170), Expect = 2e-10 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 10/130 (7%) Frame = +2 Query: 11 PAGYDCVSTPPHISTFTIPSLPN--IRGLNVCVVYRG----WWFYSFRPAIKMHNETKNF 172 P +D ST +S FTI L + IRGLN+C VY +W ++ +M+NETK Sbjct: 904 PHWFDHKSTGSSLS-FTINPLSDYKIRGLNLCTVYARDHEVYWLHAAGHYARMNNETKGT 962 Query: 173 CWEYSPNFRKPDKKEEEEYFMMLSHWKSGNALEGGDRVTVSLI----YYETLDRLVVEKI 340 W YSP F + ++E+ + LS+WK G E GD+V VS+ YY V++ Sbjct: 963 NWSYSPTFYALPEDDDED-MLWLSYWKFGGEFEVGDKVNVSVRMPFGYY-------VKEC 1014 Query: 341 GIKVVYDDDD 370 GI++VY++++ Sbjct: 1015 GIRIVYEENE 1024 >ref|XP_002512273.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548234|gb|EEF49725.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1166 Score = 58.2 bits (139), Expect = 8e-07 Identities = 44/128 (34%), Positives = 65/128 (50%), Gaps = 8/128 (6%) Frame = +2 Query: 11 PAGYDCVSTPPHISTFTIPS--LPNIRGLNVCVVY------RGWWFYSFRPAIKMHNETK 166 P Y + P IS FT+P + + GLN+C+VY G + + IK+ N+TK Sbjct: 982 PGWYSPQNEGPLIS-FTMPPSHVRKVCGLNICIVYTCNDVRNGLTDHHY---IKIWNKTK 1037 Query: 167 NFCWEYSPNFRKPDKKEEEEYFMMLSHWKSGNALEGGDRVTVSLIYYETLDRLVVEKIGI 346 + W YSP F E E+ + LSHWK + LEGGD++ VS + + I I Sbjct: 1038 DLKWTYSPIFY--GIPEPEKSMLWLSHWKLEDLLEGGDQLNVSAVMSTGYQ---AKNIRI 1092 Query: 347 KVVYDDDD 370 +VYD ++ Sbjct: 1093 HLVYDQEN 1100