BLASTX nr result
ID: Panax21_contig00017396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017396 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 68 9e-10 ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|2... 68 9e-10 ref|NP_194576.5| 26S proteasome regulatory subunit S2 1B [Arabid... 68 9e-10 emb|CAA16886.1| putative protein [Arabidopsis thaliana] gi|72697... 68 9e-10 ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulat... 67 1e-09 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 400 AGIITLLHACLDMKAIILGKYHYVLYFLVLAMQ 302 AG+IT+LHACLDMKAIILGKYHYVLYFLVLAMQ Sbjct: 779 AGLITMLHACLDMKAIILGKYHYVLYFLVLAMQ 811 >ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|222837315|gb|EEE75694.1| predicted protein [Populus trichocarpa] Length = 890 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 400 AGIITLLHACLDMKAIILGKYHYVLYFLVLAMQ 302 AG+IT+LHACLDMKAIILGKYHYVLYFLVLAMQ Sbjct: 774 AGLITMLHACLDMKAIILGKYHYVLYFLVLAMQ 806 >ref|NP_194576.5| 26S proteasome regulatory subunit S2 1B [Arabidopsis thaliana] gi|75130218|sp|Q6XJG8.1|RPN1B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 2 1B; AltName: Full=26S proteasome regulatory subunit RPN1 B; Short=AtRPN1b; AltName: Full=26S proteasome regulatory subunit S2 1B gi|32700012|gb|AAP86656.1| 26S proteasome subunit RPN1b [Arabidopsis thaliana] gi|332660090|gb|AEE85490.1| 26S proteasome regulatory subunit S2 1B [Arabidopsis thaliana] Length = 891 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 400 AGIITLLHACLDMKAIILGKYHYVLYFLVLAMQ 302 AGI+TLLHACLDMK+IILGKYHYVLYFLVLAMQ Sbjct: 776 AGIVTLLHACLDMKSIILGKYHYVLYFLVLAMQ 808 >emb|CAA16886.1| putative protein [Arabidopsis thaliana] gi|7269701|emb|CAB79649.1| putative protein [Arabidopsis thaliana] Length = 1103 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 400 AGIITLLHACLDMKAIILGKYHYVLYFLVLAMQ 302 AGI+TLLHACLDMK+IILGKYHYVLYFLVLAMQ Sbjct: 879 AGIVTLLHACLDMKSIILGKYHYVLYFLVLAMQ 911 >ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Glycine max] Length = 885 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 400 AGIITLLHACLDMKAIILGKYHYVLYFLVLAMQ 302 AG+IT+LHACLDMKAI+LGKYHYVLYFLVLAMQ Sbjct: 770 AGLITMLHACLDMKAIVLGKYHYVLYFLVLAMQ 802