BLASTX nr result
ID: Panax21_contig00017341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017341 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001783343.1| SWI/SNF class chromatin remodeling complex p... 60 2e-07 gb|AAX22009.1| SPLAYED splice variant [Arabidopsis thaliana] 59 3e-07 ref|XP_003609575.1| Helicase swr1 [Medicago truncatula] gi|35551... 59 3e-07 ref|XP_003609574.1| Helicase swr1 [Medicago truncatula] gi|35551... 59 3e-07 ref|XP_002880938.1| hypothetical protein ARALYDRAFT_481680 [Arab... 59 3e-07 >ref|XP_001783343.1| SWI/SNF class chromatin remodeling complex protein [Physcomitrella patens subsp. patens] gi|162665144|gb|EDQ51838.1| SWI/SNF class chromatin remodeling complex protein [Physcomitrella patens subsp. patens] Length = 2174 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 360 NPQVDLQAQARAHRIGQKREVLVLRFETVSS 268 NPQVDLQAQARAHRIGQKR+VLVLRFETV S Sbjct: 1903 NPQVDLQAQARAHRIGQKRDVLVLRFETVKS 1933 >gb|AAX22009.1| SPLAYED splice variant [Arabidopsis thaliana] Length = 3543 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 360 NPQVDLQAQARAHRIGQKREVLVLRFETVSS 268 NPQVDLQAQARAHRIGQK++VLVLRFETV+S Sbjct: 1172 NPQVDLQAQARAHRIGQKKDVLVLRFETVNS 1202 >ref|XP_003609575.1| Helicase swr1 [Medicago truncatula] gi|355510630|gb|AES91772.1| Helicase swr1 [Medicago truncatula] Length = 3310 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 360 NPQVDLQAQARAHRIGQKREVLVLRFETVSS 268 NPQVDLQAQARAHRIGQK++VLVLRFETVS+ Sbjct: 1423 NPQVDLQAQARAHRIGQKKDVLVLRFETVSN 1453 >ref|XP_003609574.1| Helicase swr1 [Medicago truncatula] gi|355510629|gb|AES91771.1| Helicase swr1 [Medicago truncatula] Length = 3312 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 360 NPQVDLQAQARAHRIGQKREVLVLRFETVSS 268 NPQVDLQAQARAHRIGQK++VLVLRFETVS+ Sbjct: 1423 NPQVDLQAQARAHRIGQKKDVLVLRFETVSN 1453 >ref|XP_002880938.1| hypothetical protein ARALYDRAFT_481680 [Arabidopsis lyrata subsp. lyrata] gi|297326777|gb|EFH57197.1| hypothetical protein ARALYDRAFT_481680 [Arabidopsis lyrata subsp. lyrata] Length = 3451 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 360 NPQVDLQAQARAHRIGQKREVLVLRFETVSS 268 NPQVDLQAQARAHRIGQK++VLVLRFETV+S Sbjct: 1168 NPQVDLQAQARAHRIGQKKDVLVLRFETVNS 1198