BLASTX nr result
ID: Panax21_contig00017195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017195 (640 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFU95068.1| PsaB, partial (chloroplast) [Centroplacus glaucinus] 60 3e-07 ref|YP_007374798.1| photosystem I P700 chlorophyll a apoprotein ... 60 5e-07 ref|YP_005352945.1| psaB gene product (chloroplast) [Mankyua che... 60 5e-07 ref|YP_002970643.1| photosystem I P700 apoprotein A2 [Alsophila ... 60 5e-07 ref|YP_001023700.1| photosystem I P700 chlorophyll a apoprotein ... 60 5e-07 >gb|AFU95068.1| PsaB, partial (chloroplast) [Centroplacus glaucinus] Length = 734 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 378 IITGWLHLQPKWNLGVLWFKNSKSCISYHLSGFFGAS 268 ++ GWLHLQPKW VLWFKN++S +++HLSG FG S Sbjct: 150 LLAGWLHLQPKWKPSVLWFKNAESRLNHHLSGLFGVS 186 >ref|YP_007374798.1| photosystem I P700 chlorophyll a apoprotein A2 (chloroplast) [Ophioglossum californicum] gi|441017927|gb|AGC26711.1| photosystem I P700 chlorophyll a apoprotein A2 (chloroplast) [Ophioglossum californicum] Length = 734 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 378 IITGWLHLQPKWNLGVLWFKNSKSCISYHLSGFFGAS 268 +I GWLHLQPKW G+ WFKN++S +++HLSG FG S Sbjct: 150 LIAGWLHLQPKWKPGLSWFKNAESRLNHHLSGLFGVS 186 >ref|YP_005352945.1| psaB gene product (chloroplast) [Mankyua chejuensis] gi|325975841|gb|ADZ47977.1| photosystem I P700 apoprotein A2 [Mankyua chejuensis] Length = 734 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 378 IITGWLHLQPKWNLGVLWFKNSKSCISYHLSGFFGAS 268 +I GWLHLQPKW G+ WFKN++S +++HLSG FG S Sbjct: 150 LIAGWLHLQPKWKPGLSWFKNAESRLNHHLSGLFGVS 186 >ref|YP_002970643.1| photosystem I P700 apoprotein A2 [Alsophila spinulosa] gi|218454835|gb|ACK77172.1| photosystem I P700 apoprotein A2 [Alsophila spinulosa] Length = 734 Score = 59.7 bits (143), Expect = 5e-07 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = -2 Query: 378 IITGWLHLQPKWNLGVLWFKNSKSCISYHLSGFFGAS 268 ++ GWLHLQPKW G+ WFKN++S +++HLSG FG S Sbjct: 150 LLAGWLHLQPKWKPGISWFKNAESRLNHHLSGLFGVS 186 >ref|YP_001023700.1| photosystem I P700 chlorophyll a apoprotein A2 [Angiopteris evecta] gi|158512824|sp|A2T332.1|PSAB_ANGEV RecName: Full=Photosystem I P700 chlorophyll a apoprotein A2; AltName: Full=PSI-B; AltName: Full=PsaB gi|110628303|gb|ABG79599.1| photosystem I P700 apoprotein A2 [Angiopteris evecta] Length = 734 Score = 59.7 bits (143), Expect = 5e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -2 Query: 378 IITGWLHLQPKWNLGVLWFKNSKSCISYHLSGFFGAS 268 +I GWLHLQPKW G+ WFKN++S +++HLSG FG S Sbjct: 150 LIAGWLHLQPKWKPGLSWFKNAESRLNHHLSGLFGVS 186