BLASTX nr result
ID: Panax21_contig00017085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00017085 (692 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60970.1| hypothetical protein VITISV_026408 [Vitis vinifera] 40 4e-10 >emb|CAN60970.1| hypothetical protein VITISV_026408 [Vitis vinifera] Length = 1354 Score = 40.0 bits (92), Expect(3) = 4e-10 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +2 Query: 512 DEKISFPHSALSR*GKA*YVFICARLMPTRHQNDVTKERARLLNGIV 652 D+ ++FP L+R KA Y F+ L RH ND+ KER LL IV Sbjct: 1287 DKPVTFPSIGLTRECKAWYYFLAVXLXLVRHFNDINKERVVLLYSIV 1333 Score = 39.7 bits (91), Expect(3) = 4e-10 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +3 Query: 264 TLMIVERNWFQLVEQPHPAVINIVKEFFANAIEHIGHGA---DRPVSFHDTAINEYFGL 431 T I ER W QP A++ +V+EF+AN EH + V F AIN +F L Sbjct: 1192 TANIRERKWDNFCAQPQVAIVPVVREFYANVPEHHHRXVFVRGKQVGFSGHAINVFFNL 1250 Score = 29.6 bits (65), Expect(3) = 4e-10 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 128 QFNGSKFVSEASETRFKTIIDKKNLVLEWGL 220 QF+ +KFVSE + R+ + +NL+ E GL Sbjct: 1151 QFDKTKFVSENAXNRYYDXVSNQNLIXERGL 1181