BLASTX nr result
ID: Panax21_contig00016902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016902 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC65222.1| hypothetical protein [Daucus carota] 70 2e-10 ref|XP_002325914.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >dbj|BAC65222.1| hypothetical protein [Daucus carota] Length = 374 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 440 CLPRDQDAPEYNLPRDFIEQQRAYFKEVDEFELSEEEISDNE 315 C+PRDQD E LP DFIE+QRAYFKEVDEFEL EEE SDNE Sbjct: 332 CMPRDQDTLECILPADFIEKQRAYFKEVDEFELLEEEASDNE 373 >ref|XP_002325914.1| predicted protein [Populus trichocarpa] gi|222862789|gb|EEF00296.1| predicted protein [Populus trichocarpa] Length = 199 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 428 DQDAPEYNLPRDFIEQQRAYFKEVDEFELSEEEI-SDNEVD 309 D+D ++ LP+DFIEQQRAYF E+D FELSE E+ S NE+D Sbjct: 159 DEDEKKHALPQDFIEQQRAYFAEIDAFELSEVEVDSSNELD 199