BLASTX nr result
ID: Panax21_contig00016873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016873 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA05629.1| membrane-associated salt-inducible protein like ... 57 2e-06 ref|NP_195386.1| pentatricopeptide repeat-containing protein [Ar... 57 2e-06 ref|XP_002866998.1| pentatricopeptide repeat-containing protein ... 56 3e-06 >emb|CAA05629.1| membrane-associated salt-inducible protein like [Arabidopsis thaliana] Length = 428 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 400 AKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 308 AKGLIRT KKKFPPSFLN+W+K+EEE GL S Sbjct: 383 AKGLIRTVKKKFPPSFLNAWKKLEEELGLYS 413 >ref|NP_195386.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181418|sp|Q9M065.1|PP352_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g36680, mitochondrial; Flags: Precursor gi|2464912|emb|CAB16807.1| salt-inducible like protein [Arabidopsis thaliana] gi|7270616|emb|CAB80334.1| salt-inducible like protein [Arabidopsis thaliana] gi|17381286|gb|AAL36061.1| C7A10_680/C7A10_680 [Arabidopsis thaliana] gi|24111267|gb|AAN46757.1| At4g36680/C7A10_680 [Arabidopsis thaliana] gi|332661286|gb|AEE86686.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 412 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 400 AKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 308 AKGLIRT KKKFPPSFLN+W+K+EEE GL S Sbjct: 367 AKGLIRTVKKKFPPSFLNAWKKLEEELGLYS 397 >ref|XP_002866998.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312834|gb|EFH43257.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 400 AKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 308 AKGLIRT KKKFPPSF+N+W+K+EEE GL S Sbjct: 367 AKGLIRTVKKKFPPSFMNAWKKLEEELGLYS 397