BLASTX nr result
ID: Panax21_contig00016565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016565 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601968.1| ABC transporter D family member [Medicago tr... 73 3e-11 ref|XP_003601967.1| ABC transporter D family member [Medicago tr... 73 3e-11 ref|XP_003601966.1| ABC transporter D family member [Medicago tr... 73 3e-11 ref|XP_002515826.1| peroxisomal abc transporter, putative [Ricin... 72 6e-11 ref|XP_002307090.1| peroxisomal membrane ABC transporter family,... 72 6e-11 >ref|XP_003601968.1| ABC transporter D family member [Medicago truncatula] gi|355491016|gb|AES72219.1| ABC transporter D family member [Medicago truncatula] Length = 819 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 119 ASLNGTTVKYVLEQDKAAFIRLIGVSVLQSAASSFIAPS 3 ASLNGTTVK+VLEQDKAAFIRLIG+SVLQSAASSFIAPS Sbjct: 779 ASLNGTTVKFVLEQDKAAFIRLIGISVLQSAASSFIAPS 817 >ref|XP_003601967.1| ABC transporter D family member [Medicago truncatula] gi|355491015|gb|AES72218.1| ABC transporter D family member [Medicago truncatula] Length = 1349 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 119 ASLNGTTVKYVLEQDKAAFIRLIGVSVLQSAASSFIAPS 3 ASLNGTTVK+VLEQDKAAFIRLIG+SVLQSAASSFIAPS Sbjct: 779 ASLNGTTVKFVLEQDKAAFIRLIGISVLQSAASSFIAPS 817 >ref|XP_003601966.1| ABC transporter D family member [Medicago truncatula] gi|355491014|gb|AES72217.1| ABC transporter D family member [Medicago truncatula] Length = 1356 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 119 ASLNGTTVKYVLEQDKAAFIRLIGVSVLQSAASSFIAPS 3 ASLNGTTVK+VLEQDKAAFIRLIG+SVLQSAASSFIAPS Sbjct: 786 ASLNGTTVKFVLEQDKAAFIRLIGISVLQSAASSFIAPS 824 >ref|XP_002515826.1| peroxisomal abc transporter, putative [Ricinus communis] gi|223545055|gb|EEF46568.1| peroxisomal abc transporter, putative [Ricinus communis] Length = 1339 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 119 ASLNGTTVKYVLEQDKAAFIRLIGVSVLQSAASSFIAPS 3 ASLNGTTVKYVLEQDK++FIRLIG+S+LQSAASSFIAPS Sbjct: 780 ASLNGTTVKYVLEQDKSSFIRLIGISILQSAASSFIAPS 818 >ref|XP_002307090.1| peroxisomal membrane ABC transporter family, PMP family [Populus trichocarpa] gi|222856539|gb|EEE94086.1| peroxisomal membrane ABC transporter family, PMP family [Populus trichocarpa] Length = 1309 Score = 71.6 bits (174), Expect = 6e-11 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = -3 Query: 119 ASLNGTTVKYVLEQDKAAFIRLIGVSVLQSAASSFIAPS 3 ASLNGTTVK+VLEQDKA+F+RLIGVSVLQSAASSFIAPS Sbjct: 770 ASLNGTTVKFVLEQDKASFVRLIGVSVLQSAASSFIAPS 808