BLASTX nr result
ID: Panax21_contig00016433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016433 (976 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFV15389.1| AGO10A splice variant 2 [Solanum lycopersicum] 70 2e-24 ref|XP_002517060.1| eukaryotic translation initiation factor 2c,... 70 4e-24 ref|XP_002437230.1| hypothetical protein SORBIDRAFT_10g023230 [S... 70 6e-24 gb|AFW76443.1| putative argonaute family protein [Zea mays] 70 6e-24 ref|XP_003560616.1| PREDICTED: protein argonaute PNH1-like [Brac... 70 6e-24 >gb|AFV15389.1| AGO10A splice variant 2 [Solanum lycopersicum] Length = 959 Score = 70.5 bits (171), Expect(2) = 2e-24 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 ATFKKSGNILLGTVVDTKICHPTEFDFYLYSHVGIQGTSR 1 ++ +SGNIL GTVVDTKICHPTEFDFYL SH GIQGTSR Sbjct: 822 SSIDRSGNILPGTVVDTKICHPTEFDFYLCSHAGIQGTSR 861 Score = 68.9 bits (167), Expect(2) = 2e-24 Identities = 39/74 (52%), Positives = 42/74 (56%) Frame = -1 Query: 334 ILSTDGVSEGQFYQVXXXXXXXXXXXXXXXXXXXXXXXXXXLEPNYQPLVTFIVVQNRHH 155 I DGVSEGQFYQV LEPNYQP VTFIVVQ RHH Sbjct: 763 IFYRDGVSEGQFYQVLLFELDAIRKACAS------------LEPNYQPPVTFIVVQKRHH 810 Query: 154 TQLFANYHRDRSNI 113 T+LFAN H+DRS+I Sbjct: 811 TRLFANNHKDRSSI 824 >ref|XP_002517060.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] gi|223543695|gb|EEF45223.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] Length = 986 Score = 69.7 bits (169), Expect(2) = 4e-24 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 108 KSGNILLGTVVDTKICHPTEFDFYLYSHVGIQGTSR 1 KSGNIL GTVVD+KICHPTEFDFYL SH GIQGTSR Sbjct: 855 KSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSR 890 Score = 68.6 bits (166), Expect(2) = 4e-24 Identities = 39/73 (53%), Positives = 41/73 (56%) Frame = -1 Query: 334 ILSTDGVSEGQFYQVXXXXXXXXXXXXXXXXXXXXXXXXXXLEPNYQPLVTFIVVQNRHH 155 I DGVSEGQFYQV LEPNYQP VTFIVVQ RHH Sbjct: 792 IFYRDGVSEGQFYQVLLYELDAIRKACAS------------LEPNYQPPVTFIVVQKRHH 839 Query: 154 TQLFANYHRDRSN 116 T+LFAN HRDRS+ Sbjct: 840 TRLFANNHRDRSS 852 >ref|XP_002437230.1| hypothetical protein SORBIDRAFT_10g023230 [Sorghum bicolor] gi|241915453|gb|EER88597.1| hypothetical protein SORBIDRAFT_10g023230 [Sorghum bicolor] Length = 975 Score = 70.1 bits (170), Expect(2) = 6e-24 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 ATFKKSGNILLGTVVDTKICHPTEFDFYLYSHVGIQGTSR 1 ++ KSGNIL GTVVD+KICHPTEFDFYL SH GIQGTSR Sbjct: 842 SSMDKSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSR 881 Score = 67.8 bits (164), Expect(2) = 6e-24 Identities = 37/76 (48%), Positives = 43/76 (56%) Frame = -1 Query: 334 ILSTDGVSEGQFYQVXXXXXXXXXXXXXXXXXXXXXXXXXXLEPNYQPLVTFIVVQNRHH 155 I DGVSEGQFYQV LEPNYQP VTF+VVQ RHH Sbjct: 783 IFYRDGVSEGQFYQVLLYELDAIRKACAS------------LEPNYQPPVTFVVVQKRHH 830 Query: 154 TQLFANYHRDRSNIQE 107 T+LFAN H+DRS++ + Sbjct: 831 TRLFANNHKDRSSMDK 846 >gb|AFW76443.1| putative argonaute family protein [Zea mays] Length = 966 Score = 70.1 bits (170), Expect(2) = 6e-24 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 ATFKKSGNILLGTVVDTKICHPTEFDFYLYSHVGIQGTSR 1 ++ KSGNIL GTVVD+KICHPTEFDFYL SH GIQGTSR Sbjct: 833 SSMDKSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSR 872 Score = 67.8 bits (164), Expect(2) = 6e-24 Identities = 37/76 (48%), Positives = 43/76 (56%) Frame = -1 Query: 334 ILSTDGVSEGQFYQVXXXXXXXXXXXXXXXXXXXXXXXXXXLEPNYQPLVTFIVVQNRHH 155 I DGVSEGQFYQV LEPNYQP VTF+VVQ RHH Sbjct: 774 IFYRDGVSEGQFYQVLLYELDAIRKACAS------------LEPNYQPPVTFVVVQKRHH 821 Query: 154 TQLFANYHRDRSNIQE 107 T+LFAN H+DRS++ + Sbjct: 822 TRLFANNHKDRSSMDK 837 >ref|XP_003560616.1| PREDICTED: protein argonaute PNH1-like [Brachypodium distachyon] Length = 953 Score = 70.1 bits (170), Expect(2) = 6e-24 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -2 Query: 120 ATFKKSGNILLGTVVDTKICHPTEFDFYLYSHVGIQGTSR 1 ++ KSGNIL GTVVD+KICHPTEFDFYL SH GIQGTSR Sbjct: 820 SSMDKSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSR 859 Score = 67.8 bits (164), Expect(2) = 6e-24 Identities = 37/76 (48%), Positives = 43/76 (56%) Frame = -1 Query: 334 ILSTDGVSEGQFYQVXXXXXXXXXXXXXXXXXXXXXXXXXXLEPNYQPLVTFIVVQNRHH 155 I DGVSEGQFYQV LEPNYQP VTF+VVQ RHH Sbjct: 761 IFYRDGVSEGQFYQVLLYELDAIRKACAS------------LEPNYQPPVTFVVVQKRHH 808 Query: 154 TQLFANYHRDRSNIQE 107 T+LFAN H+DRS++ + Sbjct: 809 TRLFANNHKDRSSMDK 824