BLASTX nr result
ID: Panax21_contig00016413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016413 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containi... 143 1e-32 ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containi... 122 3e-26 ref|XP_002307219.1| predicted protein [Populus trichocarpa] gi|2... 120 1e-25 ref|XP_002521729.1| pentatricopeptide repeat-containing protein,... 119 3e-25 ref|XP_003612374.1| Pentatricopeptide repeat-containing protein ... 110 9e-23 >ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Vitis vinifera] Length = 686 Score = 143 bits (361), Expect = 1e-32 Identities = 67/82 (81%), Positives = 75/82 (91%) Frame = +2 Query: 209 QSRPISTAPVPSQQHIAHLILDQKSASQALQTFRWASKLPNFTHSQSAYRALVHKLCTFR 388 QS+PIST PVP+ QHIAHLIL+QKSASQALQTFRWAS LPNF H+QS YRAL+HKLC+FR Sbjct: 82 QSKPISTTPVPTHQHIAHLILEQKSASQALQTFRWASNLPNFIHNQSTYRALIHKLCSFR 141 Query: 389 RFGTVKDLLDEMPSSIGSAPDE 454 RF TVK++LDEMPSSIGS PDE Sbjct: 142 RFETVKEVLDEMPSSIGSPPDE 163 >ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Glycine max] Length = 618 Score = 122 bits (306), Expect = 3e-26 Identities = 59/94 (62%), Positives = 73/94 (77%) Frame = +2 Query: 173 SRTTYQRRSFTFQSRPISTAPVPSQQHIAHLILDQKSASQALQTFRWASKLPNFTHSQSA 352 S T+ R F FQ+ S++ PSQ+H++ LILDQKSAS+AL+ FRWAS +PNF HSQS Sbjct: 13 SSPTHFLRRFQFQTHS-SSSSAPSQEHVSQLILDQKSASEALEYFRWASTVPNFVHSQST 71 Query: 353 YRALVHKLCTFRRFGTVKDLLDEMPSSIGSAPDE 454 YRAL+HKLCTFRRF TVK LLDEMP S+G+ P + Sbjct: 72 YRALIHKLCTFRRFDTVKQLLDEMPHSLGAPPGD 105 >ref|XP_002307219.1| predicted protein [Populus trichocarpa] gi|222856668|gb|EEE94215.1| predicted protein [Populus trichocarpa] Length = 584 Score = 120 bits (300), Expect = 1e-25 Identities = 58/79 (73%), Positives = 63/79 (79%) Frame = +2 Query: 218 PISTAPVPSQQHIAHLILDQKSASQALQTFRWASKLPNFTHSQSAYRALVHKLCTFRRFG 397 P + VP+ + I HLILDQKSA QALQTF WASKLPNFTHSQS YRAL+HKL TFRRF Sbjct: 6 PTPSLAVPTHERIVHLILDQKSAPQALQTFEWASKLPNFTHSQSTYRALIHKLLTFRRFH 65 Query: 398 TVKDLLDEMPSSIGSAPDE 454 TV+ LLDEMP SIG PDE Sbjct: 66 TVQHLLDEMPKSIGLPPDE 84 >ref|XP_002521729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539120|gb|EEF40716.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 629 Score = 119 bits (298), Expect = 3e-25 Identities = 59/90 (65%), Positives = 68/90 (75%) Frame = +2 Query: 185 YQRRSFTFQSRPISTAPVPSQQHIAHLILDQKSASQALQTFRWASKLPNFTHSQSAYRAL 364 +Q R ++ S P + VPS QHIAHLILDQ SA++ALQTF+WAS LP FTHSQS YRAL Sbjct: 21 FQFRRYSSSSTP--SLSVPSHQHIAHLILDQNSATKALQTFKWASNLPKFTHSQSTYRAL 78 Query: 365 VHKLCTFRRFGTVKDLLDEMPSSIGSAPDE 454 + KLC F RF TV LLDEMP +IGS PDE Sbjct: 79 IQKLCAFHRFDTVYQLLDEMPHAIGSPPDE 108 >ref|XP_003612374.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513709|gb|AES95332.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 110 bits (276), Expect = 9e-23 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 1/84 (1%) Frame = +2 Query: 206 FQSRPISTAPVP-SQQHIAHLILDQKSASQALQTFRWASKLPNFTHSQSAYRALVHKLCT 382 FQS S++ +P +Q H+ LILDQK++S+ALQTFRWAS FTHSQS YR L+HKLC Sbjct: 24 FQSHYSSSSSLPPTQDHLCQLILDQKTSSEALQTFRWASTFSKFTHSQSTYRTLIHKLCI 83 Query: 383 FRRFGTVKDLLDEMPSSIGSAPDE 454 FRRF TVK LLDEMP+SIG+ P E Sbjct: 84 FRRFDTVKQLLDEMPTSIGANPGE 107