BLASTX nr result
ID: Panax21_contig00016290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016290 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vi... 77 1e-12 ref|XP_004145699.1| PREDICTED: light-regulated protein-like [Cuc... 72 5e-11 gb|ACV88397.1| GA-like protein [Cucumis sativus] 72 5e-11 gb|ABV89628.1| light regulated protein-like protein [Brassica rapa] 72 6e-11 ref|XP_004170126.1| PREDICTED: LOW QUALITY PROTEIN: light-regula... 71 8e-11 >ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vinifera] gi|296088179|emb|CBI35671.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 438 VDREYLDYNSSKTVFPGEACDDLGGEFCEPEYQTGVY 328 VDREYL+YNS KTVFPGEACDDLGGEFCEPEYQ GV+ Sbjct: 100 VDREYLEYNSPKTVFPGEACDDLGGEFCEPEYQEGVF 136 >ref|XP_004145699.1| PREDICTED: light-regulated protein-like [Cucumis sativus] Length = 140 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 438 VDREYLDYNSSKTVFPGEACDDLGGEFCEPEYQTGVY 328 +DREYLDY SKTVFPGEACDDLGGEFCEPE+ GV+ Sbjct: 104 IDREYLDYADSKTVFPGEACDDLGGEFCEPEFLNGVF 140 >gb|ACV88397.1| GA-like protein [Cucumis sativus] Length = 137 Score = 72.0 bits (175), Expect = 5e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 438 VDREYLDYNSSKTVFPGEACDDLGGEFCEPEYQTGVY 328 +DREYLDY SKTVFPGEACDDLGGEFCEPE+ GV+ Sbjct: 101 IDREYLDYADSKTVFPGEACDDLGGEFCEPEFLNGVF 137 >gb|ABV89628.1| light regulated protein-like protein [Brassica rapa] Length = 138 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 438 VDREYLDYNSSKTVFPGEACDDLGGEFCEPEYQTGVY 328 VDREYL+YN+ KTVFP EACDDLGGEFCEP+YQ VY Sbjct: 102 VDREYLEYNNPKTVFPAEACDDLGGEFCEPDYQKDVY 138 >ref|XP_004170126.1| PREDICTED: LOW QUALITY PROTEIN: light-regulated protein-like [Cucumis sativus] Length = 137 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 438 VDREYLDYNSSKTVFPGEACDDLGGEFCEPEYQTGVY 328 V+REYL Y+S KTVFP EACDDLGGEFC+PEYQ GVY Sbjct: 101 VEREYLQYDSPKTVFPAEACDDLGGEFCDPEYQKGVY 137