BLASTX nr result
ID: Panax21_contig00016263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016263 (922 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46372.1| unknown [Medicago truncatula] 83 8e-14 ref|XP_003629837.1| ER lumen protein retaining receptor [Medicag... 83 8e-14 gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana bentham... 81 3e-13 ref|XP_002522261.1| er lumen protein retaining receptor, putativ... 81 4e-13 ref|XP_002267990.1| PREDICTED: ER lumen protein retaining recept... 81 4e-13 >gb|AFK46372.1| unknown [Medicago truncatula] Length = 133 Score = 83.2 bits (204), Expect = 8e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 689 FLQVFWAFSVYLEAVVILPQLVLLQRSGNVDNLTGQYVFFLG 814 FL++FWAFS+YLEAV ILPQLVLLQRSGNVDNLTGQYVFFLG Sbjct: 35 FLEIFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVFFLG 76 >ref|XP_003629837.1| ER lumen protein retaining receptor [Medicago truncatula] gi|355523859|gb|AET04313.1| ER lumen protein retaining receptor [Medicago truncatula] Length = 215 Score = 83.2 bits (204), Expect = 8e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 689 FLQVFWAFSVYLEAVVILPQLVLLQRSGNVDNLTGQYVFFLG 814 FL++FWAFS+YLEAV ILPQLVLLQRSGNVDNLTGQYVFFLG Sbjct: 117 FLEIFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVFFLG 158 >gb|ADI60302.1| ER luminal protein receptor 2a [Nicotiana benthamiana] Length = 215 Score = 81.3 bits (199), Expect = 3e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 689 FLQVFWAFSVYLEAVVILPQLVLLQRSGNVDNLTGQYVFFLG 814 F +VFWAFS+YLEAV ILPQLVLLQRSGNVDNLTGQYVFFLG Sbjct: 117 FQEVFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVFFLG 158 >ref|XP_002522261.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223538514|gb|EEF40119.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 215 Score = 80.9 bits (198), Expect = 4e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 689 FLQVFWAFSVYLEAVVILPQLVLLQRSGNVDNLTGQYVFFLG 814 F ++FWAFS+YLEAV ILPQLVLLQRSGNVDNLTGQYVFFLG Sbjct: 117 FREIFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVFFLG 158 >ref|XP_002267990.1| PREDICTED: ER lumen protein retaining receptor [Vitis vinifera] gi|297740541|emb|CBI30723.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 80.9 bits (198), Expect = 4e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 689 FLQVFWAFSVYLEAVVILPQLVLLQRSGNVDNLTGQYVFFLG 814 F ++FWAFS+YLEAV ILPQLVLLQRSGNVDNLTGQYVFFLG Sbjct: 117 FQEIFWAFSIYLEAVAILPQLVLLQRSGNVDNLTGQYVFFLG 158