BLASTX nr result
ID: Panax21_contig00016186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016186 (682 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527109.1| pseudouridylate synthase, putative [Ricinus ... 65 2e-08 ref|XP_003535557.1| PREDICTED: tRNA pseudouridine synthase 3-lik... 62 1e-07 ref|XP_002302151.1| predicted protein [Populus trichocarpa] gi|2... 62 1e-07 emb|CBI29343.3| unnamed protein product [Vitis vinifera] 60 5e-07 ref|XP_003555416.1| PREDICTED: tRNA pseudouridine synthase 3-lik... 59 9e-07 >ref|XP_002527109.1| pseudouridylate synthase, putative [Ricinus communis] gi|223533532|gb|EEF35272.1| pseudouridylate synthase, putative [Ricinus communis] Length = 438 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 582 SEGELDYVRILNKVLPKDIRVIGWCPAPTDFSA 680 SEGE+DYVR+LN+VLP DIR+IGWCP P DFSA Sbjct: 195 SEGEIDYVRVLNRVLPNDIRIIGWCPVPNDFSA 227 >ref|XP_003535557.1| PREDICTED: tRNA pseudouridine synthase 3-like [Glycine max] Length = 426 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 585 EGELDYVRILNKVLPKDIRVIGWCPAPTDFSA 680 EGE+DYVR+LN+VLP DIR++GWCPAP DF A Sbjct: 175 EGEIDYVRVLNRVLPNDIRIMGWCPAPVDFHA 206 >ref|XP_002302151.1| predicted protein [Populus trichocarpa] gi|222843877|gb|EEE81424.1| predicted protein [Populus trichocarpa] Length = 465 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 588 GELDYVRILNKVLPKDIRVIGWCPAPTDFSA 680 GE+DYVR+LN VLPKDIR++GWCP P+DFSA Sbjct: 190 GEIDYVRVLNGVLPKDIRIVGWCPVPSDFSA 220 >emb|CBI29343.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 582 SEGELDYVRILNKVLPKDIRVIGWCPAPTDFSA 680 SEGE+DY+R+LN+VLPKDIRV+GWCP P F A Sbjct: 211 SEGEIDYMRVLNRVLPKDIRVMGWCPVPIGFHA 243 >ref|XP_003555416.1| PREDICTED: tRNA pseudouridine synthase 3-like [Glycine max] Length = 426 Score = 58.9 bits (141), Expect = 9e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 585 EGELDYVRILNKVLPKDIRVIGWCPAPTDFSA 680 EGE+DYV +LN+VLP DIR++GWCPAP DF A Sbjct: 175 EGEIDYVGVLNRVLPNDIRIMGWCPAPVDFHA 206