BLASTX nr result
ID: Panax21_contig00016064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016064 (882 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI18036.3| unnamed protein product [Vitis vinifera] 60 5e-07 ref|XP_002267484.1| PREDICTED: B3 domain-containing protein Os07... 60 5e-07 ref|XP_002323669.1| predicted protein [Populus trichocarpa] gi|2... 57 4e-06 >emb|CBI18036.3| unnamed protein product [Vitis vinifera] Length = 856 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -2 Query: 161 DMNWYMSDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDN*HALELKL 3 D+ W+ ++KHGG G L P ML E+KR+R IG KSKRLLID ALEL+L Sbjct: 473 DIGWHKTEKHGGKTREGLLLPSMLVPEKKRTRTIGSKSKRLLIDGQDALELRL 525 >ref|XP_002267484.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Vitis vinifera] Length = 924 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -2 Query: 161 DMNWYMSDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLLIDN*HALELKL 3 D+ W+ ++KHGG G L P ML E+KR+R IG KSKRLLID ALEL+L Sbjct: 498 DIGWHKTEKHGGKTREGLLLPSMLVPEKKRTRTIGSKSKRLLIDGQDALELRL 550 >ref|XP_002323669.1| predicted protein [Populus trichocarpa] gi|222868299|gb|EEF05430.1| predicted protein [Populus trichocarpa] Length = 917 Score = 57.4 bits (137), Expect = 4e-06 Identities = 34/71 (47%), Positives = 42/71 (59%), Gaps = 4/71 (5%) Frame = -2 Query: 203 NTDLHFIGYFFH----EFDMNWYMSDKHGGNGMGGSLPPIMLARERKRSRNIGLKSKRLL 36 +TD H H D++W+ S+K G L P +LA ERKR RNIG KSKRLL Sbjct: 475 STDTHLSALSKHLHSASGDISWHKSEKQEARTRDGLLLPSLLAPERKRLRNIGSKSKRLL 534 Query: 35 IDN*HALELKL 3 ID+ ALELK+ Sbjct: 535 IDSLDALELKV 545