BLASTX nr result
ID: Panax21_contig00016034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00016034 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU24588.1| unknown [Glycine max] 55 4e-06 ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 55 6e-06 >gb|ACU24588.1| unknown [Glycine max] Length = 287 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -3 Query: 460 ADGISVPEEEKEGYAWLQEMDKPEGSDLYRKLYSGPKIV 344 +DG+S+PEEE+ Y WLQE +KPE + K+YSGPKIV Sbjct: 247 SDGLSIPEEERTAYEWLQEKEKPENLKVVVKMYSGPKIV 285 >ref|XP_003552515.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Length = 288 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 457 DGISVPEEEKEGYAWLQEMDKPEGSDLYRKLYSGPKIV 344 DG+S+PEEE+ Y WLQE +KPE + K+YSGPKIV Sbjct: 249 DGLSIPEEERTAYEWLQEKEKPENLKVVVKMYSGPKIV 286