BLASTX nr result
ID: Panax21_contig00015940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015940 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518797.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 ref|XP_002285039.1| PREDICTED: nodulation protein H [Vitis vinif... 65 7e-09 ref|XP_002327114.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_004172113.1| PREDICTED: uncharacterized LOC101217742 [Cuc... 57 1e-06 ref|XP_003632512.1| PREDICTED: uncharacterized protein LOC100254... 57 2e-06 >ref|XP_002518797.1| conserved hypothetical protein [Ricinus communis] gi|223542178|gb|EEF43722.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -1 Query: 132 ADDLCFFSKDSSTLKQ-KKSPLLLRMIVLAFAMFFGVSICSICIK 1 ADDLCFFSKD+ +K KKSPL+LRM+VLAF M GV ICSIC+K Sbjct: 2 ADDLCFFSKDAFIIKSPKKSPLVLRMVVLAFVMVCGVYICSICLK 46 >ref|XP_002285039.1| PREDICTED: nodulation protein H [Vitis vinifera] gi|297741312|emb|CBI32443.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 132 ADDLCFFSKDSSTLKQ-KKSPLLLRMIVLAFAMFFGVSICSICIK 1 ADDLCFF+KDS K KKSPL+LRMIVL FAM GV ICSIC+K Sbjct: 2 ADDLCFFTKDSFVFKAPKKSPLVLRMIVLVFAMVCGVYICSICLK 46 >ref|XP_002327114.1| predicted protein [Populus trichocarpa] gi|222835429|gb|EEE73864.1| predicted protein [Populus trichocarpa] Length = 344 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -1 Query: 129 DDLCFFSKDSSTLK-QKKSPLLLRMIVLAFAMFFGVSICSICIK 1 +DLCFF+KD+ +K KKSPLLLR++V+AFAM GV ICSICIK Sbjct: 3 EDLCFFNKDALVIKGPKKSPLLLRLVVVAFAMVCGVYICSICIK 46 >ref|XP_004172113.1| PREDICTED: uncharacterized LOC101217742 [Cucumis sativus] Length = 340 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 132 ADDLCFFSKDSSTLKQ-KKSPLLLRMIVLAFAMFFGVSICSICIK 1 A+++CFF+KD+ LK KKSPLLLRM VL FAM V ICSIC+K Sbjct: 2 AENICFFNKDTLILKPPKKSPLLLRMAVLMFAMVCSVYICSICVK 46 >ref|XP_003632512.1| PREDICTED: uncharacterized protein LOC100254393 isoform 2 [Vitis vinifera] gi|296082441|emb|CBI21446.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 132 ADDLCFFSKDSSTLKQ-KKSPLLLRMIVLAFAMFFGVSICSICIK 1 A+DLCFF+KD+ +K KKSP LLRM VL FAM GV IC IC+K Sbjct: 2 AEDLCFFNKDTLIIKPPKKSPKLLRMTVLVFAMVCGVYICLICLK 46