BLASTX nr result
ID: Panax21_contig00015708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015708 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631941.1| PREDICTED: AMSH-like ubiquitin thiolesterase... 134 1e-29 emb|CBI22917.3| unnamed protein product [Vitis vinifera] 134 1e-29 ref|XP_002519188.1| amsh, putative [Ricinus communis] gi|2235415... 108 3e-22 ref|NP_680708.6| AMSH-like ubiquitin thiolesterase 3 [Arabidopsi... 100 2e-19 gb|AAV85709.1| At4g16144 [Arabidopsis thaliana] 99 5e-19 >ref|XP_003631941.1| PREDICTED: AMSH-like ubiquitin thiolesterase 3-like [Vitis vinifera] Length = 459 Score = 134 bits (336), Expect = 1e-29 Identities = 73/129 (56%), Positives = 90/129 (69%) Frame = +3 Query: 3 IILLRYSSLVSETIPFHRDYQVSYPKERSNYRKKLSIVIDELESLKPKFQRLVDEPSKVH 182 IILLR+SSL+SETIPFHRDYQV PKER+ YRKKL V+DELESLKP+FQR V+E +K H Sbjct: 53 IILLRFSSLLSETIPFHRDYQVLLPKERAIYRKKLLAVLDELESLKPEFQRQVNELNKAH 112 Query: 183 AGTQQYQFDGPDRTPYASESSSFEWPFVSNKASSGFQNMRSQSSITAPLSSWKHGNDRSQ 362 +QQ Q D +RTPY SE SS +WP V+ K F N ++ S AP SWK+ ND +Q Sbjct: 113 TVSQQQQIDVLERTPYDSEISS-QWPPVNKKPFPSFDNKQAVS--RAPQISWKYKNDHTQ 169 Query: 363 AFPSTSIDM 389 S + + Sbjct: 170 VLSSNPMQV 178 >emb|CBI22917.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 134 bits (336), Expect = 1e-29 Identities = 73/129 (56%), Positives = 90/129 (69%) Frame = +3 Query: 3 IILLRYSSLVSETIPFHRDYQVSYPKERSNYRKKLSIVIDELESLKPKFQRLVDEPSKVH 182 IILLR+SSL+SETIPFHRDYQV PKER+ YRKKL V+DELESLKP+FQR V+E +K H Sbjct: 53 IILLRFSSLLSETIPFHRDYQVLLPKERAIYRKKLLAVLDELESLKPEFQRQVNELNKAH 112 Query: 183 AGTQQYQFDGPDRTPYASESSSFEWPFVSNKASSGFQNMRSQSSITAPLSSWKHGNDRSQ 362 +QQ Q D +RTPY SE SS +WP V+ K F N ++ S AP SWK+ ND +Q Sbjct: 113 TVSQQQQIDVLERTPYDSEISS-QWPPVNKKPFPSFDNKQAVS--RAPQISWKYKNDHTQ 169 Query: 363 AFPSTSIDM 389 S + + Sbjct: 170 VLSSNPMQV 178 >ref|XP_002519188.1| amsh, putative [Ricinus communis] gi|223541503|gb|EEF43052.1| amsh, putative [Ricinus communis] Length = 456 Score = 108 bits (271), Expect = 3e-22 Identities = 64/127 (50%), Positives = 81/127 (63%) Frame = +3 Query: 3 IILLRYSSLVSETIPFHRDYQVSYPKERSNYRKKLSIVIDELESLKPKFQRLVDEPSKVH 182 IILLR+SSLVSETIPFH+DY VS PKER Y K L V++ELESLKP F R V+E + Sbjct: 48 IILLRFSSLVSETIPFHKDYHVSLPKERVAYIKSLLGVLNELESLKPVFHRRVEEINNAF 107 Query: 183 AGTQQYQFDGPDRTPYASESSSFEWPFVSNKASSGFQNMRSQSSITAPLSSWKHGNDRSQ 362 A TQ + DGP+R SE S E+P V N+ S N++ + A SSWK+ N+ +Q Sbjct: 108 ARTQLCELDGPERLSCDSEPSPSEYPLV-NRTSYTNTNVKRPYGV-ALQSSWKYDNNNTQ 165 Query: 363 AFPSTSI 383 S S+ Sbjct: 166 VSSSNSL 172 >ref|NP_680708.6| AMSH-like ubiquitin thiolesterase 3 [Arabidopsis thaliana] gi|302595939|sp|Q5PNU3.2|AMSH3_ARATH RecName: Full=AMSH-like ubiquitin thioesterase 3; AltName: Full=Deubiquitinating enzyme AMSH3 gi|332658301|gb|AEE83701.1| AMSH-like ubiquitin thiolesterase 3 [Arabidopsis thaliana] Length = 507 Score = 100 bits (248), Expect = 2e-19 Identities = 58/128 (45%), Positives = 81/128 (63%) Frame = +3 Query: 3 IILLRYSSLVSETIPFHRDYQVSYPKERSNYRKKLSIVIDELESLKPKFQRLVDEPSKVH 182 I+LLRYSSL+SETIPFHRDYQ S P+ER RK+L VI+ELESLKP+F +LVD+ ++V Sbjct: 48 IMLLRYSSLISETIPFHRDYQASLPQERLGSRKRLRAVINELESLKPEFNQLVDKLNRVE 107 Query: 183 AGTQQYQFDGPDRTPYASESSSFEWPFVSNKASSGFQNMRSQSSITAPLSSWKHGNDRSQ 362 ++Q DG D + S + EWP ++KAS ++ + P SW + N+ + Sbjct: 108 DESRQ---DGSDLPVVSYSSDAVEWP-PAHKASYSRPDINKPLPTSQP--SWTYNNNLTS 161 Query: 363 AFPSTSID 386 + T ID Sbjct: 162 SSNRTQID 169 >gb|AAV85709.1| At4g16144 [Arabidopsis thaliana] Length = 507 Score = 98.6 bits (244), Expect = 5e-19 Identities = 57/128 (44%), Positives = 81/128 (63%) Frame = +3 Query: 3 IILLRYSSLVSETIPFHRDYQVSYPKERSNYRKKLSIVIDELESLKPKFQRLVDEPSKVH 182 I+LLRYSSL+SETIPFHRDYQ S P+ER R++L VI+ELESLKP+F +LVD+ ++V Sbjct: 48 IMLLRYSSLISETIPFHRDYQASLPQERLGSRERLRAVINELESLKPEFNQLVDKLNRVE 107 Query: 183 AGTQQYQFDGPDRTPYASESSSFEWPFVSNKASSGFQNMRSQSSITAPLSSWKHGNDRSQ 362 ++Q DG D + S + EWP ++KAS ++ + P SW + N+ + Sbjct: 108 DESRQ---DGSDLPVVSYSSDAVEWP-PAHKASYSRPDINKPLPTSQP--SWTYNNNLTS 161 Query: 363 AFPSTSID 386 + T ID Sbjct: 162 SSNRTQID 169