BLASTX nr result
ID: Panax21_contig00015532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015532 (844 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519464.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 73 7e-11 emb|CBI39086.3| unnamed protein product [Vitis vinifera] 73 7e-11 ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 73 7e-11 ref|XP_003542329.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 73 9e-11 ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putat... 72 1e-10 >ref|XP_003519464.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Glycine max] Length = 1118 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 3 QAVDEPQASRFTWMIENFSRLNTKKLYSEIFVVGGYKWYLIL 128 Q V++P SRFTW IENFSR+NTKKLYSEIFVVGGYKW +++ Sbjct: 48 QPVEDPSTSRFTWKIENFSRMNTKKLYSEIFVVGGYKWRVLI 89 >emb|CBI39086.3| unnamed protein product [Vitis vinifera] Length = 1116 Score = 73.2 bits (178), Expect = 7e-11 Identities = 41/81 (50%), Positives = 51/81 (62%), Gaps = 7/81 (8%) Frame = +3 Query: 3 QAVDEPQASRFTWMIENFSRLNTKKLYSEIFVVGGYKWYLIL-------THLV*LMCEPL 161 Q V++PQ SRFTW IENFSRLNTKK YSEIFVVGG+KW +++ HL + Sbjct: 46 QPVEDPQTSRFTWTIENFSRLNTKKHYSEIFVVGGFKWRVLIFPKGNNVDHL------SM 99 Query: 162 TLFIMPIA**VFGWSRRAEAS 224 L + A +GWSR A+ S Sbjct: 100 YLDVADSATLPYGWSRYAQFS 120 >ref|XP_002267555.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vitis vinifera] Length = 1117 Score = 73.2 bits (178), Expect = 7e-11 Identities = 41/81 (50%), Positives = 51/81 (62%), Gaps = 7/81 (8%) Frame = +3 Query: 3 QAVDEPQASRFTWMIENFSRLNTKKLYSEIFVVGGYKWYLIL-------THLV*LMCEPL 161 Q V++PQ SRFTW IENFSRLNTKK YSEIFVVGG+KW +++ HL + Sbjct: 46 QPVEDPQTSRFTWTIENFSRLNTKKHYSEIFVVGGFKWRVLIFPKGNNVDHL------SM 99 Query: 162 TLFIMPIA**VFGWSRRAEAS 224 L + A +GWSR A+ S Sbjct: 100 YLDVADSATLPYGWSRYAQFS 120 >ref|XP_003542329.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 13-like [Glycine max] Length = 1118 Score = 72.8 bits (177), Expect = 9e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 QAVDEPQASRFTWMIENFSRLNTKKLYSEIFVVGGYKWYLIL 128 Q V++P +SRFTW I+NFSRLNTKKLYSEIFVVGGYKW +++ Sbjct: 47 QPVEDPPSSRFTWRIDNFSRLNTKKLYSEIFVVGGYKWRVLI 88 >ref|XP_002514434.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223546430|gb|EEF47930.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 1109 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/81 (45%), Positives = 52/81 (64%), Gaps = 7/81 (8%) Frame = +3 Query: 3 QAVDEPQASRFTWMIENFSRLNTKKLYSEIFVVGGYKWYLIL-------THLV*LMCEPL 161 Q+ D+P ++RFTW I+NFSRLNTKKLYS++F+VGGYKW +++ HL + Sbjct: 45 QSADDPPSARFTWTIDNFSRLNTKKLYSDVFIVGGYKWRILIFPKGNNVDHL------SM 98 Query: 162 TLFIMPIA**VFGWSRRAEAS 224 L + A +GWSR A+ S Sbjct: 99 YLDVADSATLPYGWSRYAQFS 119