BLASTX nr result
ID: Panax21_contig00015463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015463 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK73021.1|AF367245_1 ceramide glucosyltransferase [Gossypium... 75 4e-12 ref|NP_001189555.1| nucleotide-diphospho-sugar transferase domai... 75 6e-12 ref|XP_002886016.1| hypothetical protein ARALYDRAFT_319569 [Arab... 75 6e-12 ref|NP_565460.1| nucleotide-diphospho-sugar transferase domain-c... 75 6e-12 gb|AAL11579.1|AF424585_1 At2g19880/F6F22.9 [Arabidopsis thaliana] 74 1e-11 >gb|AAK73021.1|AF367245_1 ceramide glucosyltransferase [Gossypium arboreum] Length = 520 Score = 75.5 bits (184), Expect = 4e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 ERIKEKGPKFTDLGGKHLYGRRGTPTKVSILGYLSRSLAHWRQPKKYDV 149 ER K +GPKFTDLGGKHLYG++G P K S L L+RSL W QPKKY+V Sbjct: 472 ERNKGRGPKFTDLGGKHLYGKKGAPPKASFLSSLARSLCQWHQPKKYEV 520 >ref|NP_001189555.1| nucleotide-diphospho-sugar transferase domain-containing protein [Arabidopsis thaliana] gi|330251844|gb|AEC06938.1| nucleotide-diphospho-sugar transferase domain-containing protein [Arabidopsis thaliana] Length = 520 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 ERIKEKGPKFTDLGGKHLYGRRGTPTKVSILGYLSRSLAHWRQPKKYDV 149 ER K+ GP TDLGGKHLYG++G P K S L L R+LAHWRQPKK+DV Sbjct: 472 ERRKDMGPTKTDLGGKHLYGKKGAPQKASFLSSLGRNLAHWRQPKKFDV 520 >ref|XP_002886016.1| hypothetical protein ARALYDRAFT_319569 [Arabidopsis lyrata subsp. lyrata] gi|297331856|gb|EFH62275.1| hypothetical protein ARALYDRAFT_319569 [Arabidopsis lyrata subsp. lyrata] Length = 521 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 ERIKEKGPKFTDLGGKHLYGRRGTPTKVSILGYLSRSLAHWRQPKKYDV 149 ER K+ GP TDLGGKHLYG++G P K S L L R+LAHWRQPKK+DV Sbjct: 473 ERRKDMGPAKTDLGGKHLYGKKGAPQKASFLSSLGRNLAHWRQPKKFDV 521 >ref|NP_565460.1| nucleotide-diphospho-sugar transferase domain-containing protein [Arabidopsis thaliana] gi|20197292|gb|AAC62128.2| expressed protein [Arabidopsis thaliana] gi|330251843|gb|AEC06937.1| nucleotide-diphospho-sugar transferase domain-containing protein [Arabidopsis thaliana] Length = 519 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = +3 Query: 3 ERIKEKGPKFTDLGGKHLYGRRGTPTKVSILGYLSRSLAHWRQPKKYDV 149 ER K+ GP TDLGGKHLYG++G P K S L L R+LAHWRQPKK+DV Sbjct: 471 ERRKDMGPTKTDLGGKHLYGKKGAPQKASFLSSLGRNLAHWRQPKKFDV 519 >gb|AAL11579.1|AF424585_1 At2g19880/F6F22.9 [Arabidopsis thaliana] Length = 519 Score = 74.3 bits (181), Expect = 1e-11 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 3 ERIKEKGPKFTDLGGKHLYGRRGTPTKVSILGYLSRSLAHWRQPKKYDV 149 ER K+ GP TDLGGKHLYG++G P K S + L R+LAHWRQPKK+DV Sbjct: 471 ERRKDMGPTKTDLGGKHLYGKKGAPQKASFISSLGRNLAHWRQPKKFDV 519