BLASTX nr result
ID: Panax21_contig00015387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015387 (591 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51565.1|AC027034_11 n-calpain-1 large subunit, putative; 1... 110 2e-22 ref|NP_001185238.1| calpain-type cysteine protease [Arabidopsis ... 102 5e-20 ref|NP_175932.2| calpain-type cysteine protease [Arabidopsis tha... 102 5e-20 gb|AAL67128.1| putative n-calpain-1 large subunit [Arabidopsis t... 102 5e-20 ref|XP_003629937.1| Calpain-like protein [Medicago truncatula] g... 101 8e-20 >gb|AAG51565.1|AC027034_11 n-calpain-1 large subunit, putative; 13921-23959 [Arabidopsis thaliana] Length = 2143 Score = 110 bits (275), Expect = 2e-22 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +1 Query: 355 VREVDGHKLVQIRKPWANEVEWNGPWSDSSPEWSDRMKHKLKHVPQVMYNFLVGGQW 525 VREVDGH+LVQIR PWANEVEWNGPWSDSSPEW+DRMKHKLKHVPQ+ Y+ V GQW Sbjct: 1954 VREVDGHRLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQMRYS--VNGQW 2008 >ref|NP_001185238.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195115|gb|AEE33236.1| calpain-type cysteine protease [Arabidopsis thaliana] Length = 2179 Score = 102 bits (254), Expect = 5e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 355 VREVDGHKLVQIRKPWANEVEWNGPWSDSSPEWSDRMKHKLKHVPQ 492 VREVDGH+LVQIR PWANEVEWNGPWSDSSPEW+DRMKHKLKHVPQ Sbjct: 1954 VREVDGHRLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQ 1999 >ref|NP_175932.2| calpain-type cysteine protease [Arabidopsis thaliana] gi|30695926|ref|NP_850965.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|30695928|ref|NP_850966.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|30695930|ref|NP_850967.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|20268660|gb|AAL38186.1| calpain-like protein [Arabidopsis thaliana] gi|332195111|gb|AEE33232.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195112|gb|AEE33233.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195113|gb|AEE33234.1| calpain-type cysteine protease [Arabidopsis thaliana] gi|332195114|gb|AEE33235.1| calpain-type cysteine protease [Arabidopsis thaliana] Length = 2151 Score = 102 bits (254), Expect = 5e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 355 VREVDGHKLVQIRKPWANEVEWNGPWSDSSPEWSDRMKHKLKHVPQ 492 VREVDGH+LVQIR PWANEVEWNGPWSDSSPEW+DRMKHKLKHVPQ Sbjct: 1926 VREVDGHRLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQ 1971 >gb|AAL67128.1| putative n-calpain-1 large subunit [Arabidopsis thaliana] Length = 549 Score = 102 bits (254), Expect = 5e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +1 Query: 355 VREVDGHKLVQIRKPWANEVEWNGPWSDSSPEWSDRMKHKLKHVPQ 492 VREVDGH+LVQIR PWANEVEWNGPWSDSSPEW+DRMKHKLKHVPQ Sbjct: 324 VREVDGHRLVQIRNPWANEVEWNGPWSDSSPEWTDRMKHKLKHVPQ 369 >ref|XP_003629937.1| Calpain-like protein [Medicago truncatula] gi|355523959|gb|AET04413.1| Calpain-like protein [Medicago truncatula] Length = 2328 Score = 101 bits (252), Expect = 8e-20 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +1 Query: 355 VREVDGHKLVQIRKPWANEVEWNGPWSDSSPEWSDRMKHKLKHVPQ 492 VREVDGHKLVQIR PWANEVEWNGPWSDSSPEW+DR+KHKLKH+PQ Sbjct: 2103 VREVDGHKLVQIRNPWANEVEWNGPWSDSSPEWTDRIKHKLKHIPQ 2148