BLASTX nr result
ID: Panax21_contig00015352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015352 (1244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533339.1| conserved hypothetical protein [Ricinus comm... 67 1e-08 >ref|XP_002533339.1| conserved hypothetical protein [Ricinus communis] gi|223526830|gb|EEF29048.1| conserved hypothetical protein [Ricinus communis] Length = 138 Score = 66.6 bits (161), Expect = 1e-08 Identities = 44/90 (48%), Positives = 49/90 (54%), Gaps = 1/90 (1%) Frame = +2 Query: 716 VERRKMEYQRSFSQG-HGRRMFSSKSYFSLESLFLLICLTASXXXXXXXXXXXXXXXXXX 892 VE++KMEYQRS SQG GRR+F + SYFSLESL LLICLTAS Sbjct: 51 VEKKKMEYQRSLSQGSSGRRLFPA-SYFSLESLLLLICLTAS-LLILPLILPPLPPPPFL 108 Query: 893 XXXXXXXXXXXXXXXAFMPSNVRDITYKYV 982 AFMP+N RDITY YV Sbjct: 109 LLLLPIGILAVLMILAFMPANARDITYTYV 138