BLASTX nr result
ID: Panax21_contig00015200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015200 (691 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147860.1| PREDICTED: tubby-like F-box protein 5-like [... 54 9e-15 ref|XP_002300764.1| f-box family protein [Populus trichocarpa] g... 56 3e-14 ref|XP_002510406.1| phosphoric diester hydrolase, putative [Rici... 53 7e-14 ref|XP_003517227.1| PREDICTED: tubby-like F-box protein 5-like [... 52 1e-13 ref|XP_003537592.1| PREDICTED: tubby-like F-box protein 5-like [... 52 1e-13 >ref|XP_004147860.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus] gi|449476828|ref|XP_004154845.1| PREDICTED: tubby-like F-box protein 5-like [Cucumis sativus] Length = 382 Score = 53.5 bits (127), Expect(2) = 9e-15 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 495 PRPRDSPIQCYIKRGRATSTYQLYLGLSP 409 P PRD+PIQC+IKR RATST++LYLGLSP Sbjct: 92 PGPRDTPIQCFIKRERATSTFRLYLGLSP 120 Score = 52.4 bits (124), Expect(2) = 9e-15 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -3 Query: 689 CRSWRAKTKEVIRTPEQCGLFTFPMSLK 606 CRSWR TKEV+RTPEQCG TFP+SLK Sbjct: 63 CRSWRMITKEVVRTPEQCGWITFPISLK 90 >ref|XP_002300764.1| f-box family protein [Populus trichocarpa] gi|222842490|gb|EEE80037.1| f-box family protein [Populus trichocarpa] Length = 416 Score = 56.2 bits (134), Expect(2) = 3e-14 Identities = 31/52 (59%), Positives = 34/52 (65%) Frame = -2 Query: 495 PRPRDSPIQCYIKRGRATSTYQLYLGLSPGK*HSCLIDDLNKSNLFLNKYIK 340 P PRD+PIQC+IKR RATSTY LYLGLSP L D+NK L K K Sbjct: 121 PGPRDAPIQCFIKRERATSTYLLYLGLSP-----ALSGDMNKVLLAAKKIRK 167 Score = 48.1 bits (113), Expect(2) = 3e-14 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 689 CRSWRAKTKEVIRTPEQCGLFTFPMSLK 606 C+SWR TK V++TPEQCG TFP+SLK Sbjct: 92 CKSWREITKTVVKTPEQCGCITFPISLK 119 >ref|XP_002510406.1| phosphoric diester hydrolase, putative [Ricinus communis] gi|223551107|gb|EEF52593.1| phosphoric diester hydrolase, putative [Ricinus communis] Length = 413 Score = 52.8 bits (125), Expect(2) = 7e-14 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 495 PRPRDSPIQCYIKRGRATSTYQLYLGLSP 409 P PRD+PIQC+I+R RATSTY LYLGLSP Sbjct: 118 PGPRDAPIQCFIRRERATSTYLLYLGLSP 146 Score = 50.1 bits (118), Expect(2) = 7e-14 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -3 Query: 689 CRSWRAKTKEVIRTPEQCGLFTFPMSLK 606 C+SWR TKE+++TPEQCG TFP+SLK Sbjct: 89 CKSWREITKEIVKTPEQCGCLTFPISLK 116 >ref|XP_003517227.1| PREDICTED: tubby-like F-box protein 5-like [Glycine max] Length = 415 Score = 52.0 bits (123), Expect(2) = 1e-13 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 689 CRSWRAKTKEVIRTPEQCGLFTFPMSLK 606 C+SWRA TKE+++TPEQCG TFP+SLK Sbjct: 90 CKSWRAVTKEIVKTPEQCGRLTFPISLK 117 Score = 50.1 bits (118), Expect(2) = 1e-13 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 495 PRPRDSPIQCYIKRGRATSTYQLYLGLSPGK 403 P PRDSPIQC+I+R R TSTY LY+GL P + Sbjct: 119 PGPRDSPIQCFIRRNRETSTYLLYIGLVPSE 149 >ref|XP_003537592.1| PREDICTED: tubby-like F-box protein 5-like [Glycine max] Length = 414 Score = 52.0 bits (123), Expect(2) = 1e-13 Identities = 20/28 (71%), Positives = 25/28 (89%) Frame = -3 Query: 689 CRSWRAKTKEVIRTPEQCGLFTFPMSLK 606 C+SWRA TKE+++TPEQCG TFP+SLK Sbjct: 90 CKSWRAVTKEIVKTPEQCGRLTFPISLK 117 Score = 50.1 bits (118), Expect(2) = 1e-13 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -2 Query: 495 PRPRDSPIQCYIKRGRATSTYQLYLGLSPGK 403 P PRDSPIQC+I+R R TSTY LY+GL P + Sbjct: 119 PGPRDSPIQCFIRRNRETSTYLLYIGLVPSE 149