BLASTX nr result
ID: Panax21_contig00015137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015137 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|... 56 3e-06 >ref|XP_002514101.1| Thioredoxin, putative [Ricinus communis] gi|223546557|gb|EEF48055.1| Thioredoxin, putative [Ricinus communis] Length = 227 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 386 NSSSTSYFVPRFCFRPAKNSLSFKVHATIDETDQPKWW 499 +SSS++ VPRF P K LSFKVHAT+ ETDQPKWW Sbjct: 45 SSSSSAASVPRFSSMPRKQLLSFKVHATVAETDQPKWW 82