BLASTX nr result
ID: Panax21_contig00015125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015125 (731 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT66766.2| Mitochondrial carrier protein [Solanum demissum] 116 5e-24 emb|CBI31931.3| unnamed protein product [Vitis vinifera] 115 9e-24 ref|XP_002268605.1| PREDICTED: mitochondrial uncoupling protein ... 115 9e-24 emb|CAN75338.1| hypothetical protein VITISV_014417 [Vitis vinifera] 113 4e-23 ref|XP_003591661.1| Mitochondrial uncoupling protein [Medicago t... 112 6e-23 >gb|AAT66766.2| Mitochondrial carrier protein [Solanum demissum] Length = 305 Score = 116 bits (290), Expect = 5e-24 Identities = 51/58 (87%), Positives = 52/58 (89%) Frame = +3 Query: 3 GKVKYKNSYDCLVKTVRVEGFKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAGLPSF 176 G KY+NSYDCLVKTVRVEG KALWKGFFPTWARLGPWQFVFW SYEKFRQIA L SF Sbjct: 248 GNCKYRNSYDCLVKTVRVEGLKALWKGFFPTWARLGPWQFVFWASYEKFRQIASLSSF 305 >emb|CBI31931.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 115 bits (288), Expect = 9e-24 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 GKVKYKNSYDCLVKTVRVEGFKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAGLPSF 176 GK Y NSYDCLVKTVRVEG +ALWKGFFPTWARLGPWQFVFWVSYEKFR++AGL SF Sbjct: 223 GKSMYNNSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELAGLSSF 280 >ref|XP_002268605.1| PREDICTED: mitochondrial uncoupling protein 4 [Vitis vinifera] Length = 299 Score = 115 bits (288), Expect = 9e-24 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +3 Query: 3 GKVKYKNSYDCLVKTVRVEGFKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAGLPSF 176 GK Y NSYDCLVKTVRVEG +ALWKGFFPTWARLGPWQFVFWVSYEKFR++AGL SF Sbjct: 242 GKSMYNNSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELAGLSSF 299 >emb|CAN75338.1| hypothetical protein VITISV_014417 [Vitis vinifera] Length = 280 Score = 113 bits (283), Expect = 4e-23 Identities = 49/58 (84%), Positives = 52/58 (89%) Frame = +3 Query: 3 GKVKYKNSYDCLVKTVRVEGFKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAGLPSF 176 GK Y NSYDCLVKTVRVEG +ALWKGFFPTWARLGPWQFVFWVSYEKFR++ GL SF Sbjct: 223 GKSMYNNSYDCLVKTVRVEGLRALWKGFFPTWARLGPWQFVFWVSYEKFRELXGLSSF 280 >ref|XP_003591661.1| Mitochondrial uncoupling protein [Medicago truncatula] gi|358346071|ref|XP_003637096.1| Mitochondrial uncoupling protein [Medicago truncatula] gi|355480709|gb|AES61912.1| Mitochondrial uncoupling protein [Medicago truncatula] gi|355503031|gb|AES84234.1| Mitochondrial uncoupling protein [Medicago truncatula] Length = 302 Score = 112 bits (281), Expect = 6e-23 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = +3 Query: 3 GKVKYKNSYDCLVKTVRVEGFKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAGLPSF 176 G V Y++SYDCLVKTV+VEG +ALWKGFFPTWARLGPWQFVFWVSYEKFR++AGL SF Sbjct: 245 GNVLYRSSYDCLVKTVKVEGIRALWKGFFPTWARLGPWQFVFWVSYEKFRKLAGLSSF 302