BLASTX nr result
ID: Panax21_contig00015073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015073 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299189.1| predicted protein [Populus trichocarpa] gi|2... 108 7e-22 ref|XP_002280567.1| PREDICTED: GPI mannosyltransferase 1 [Vitis ... 107 1e-21 ref|XP_002529987.1| conserved hypothetical protein [Ricinus comm... 106 2e-21 gb|AFK35780.1| unknown [Lotus japonicus] 104 1e-20 ref|XP_002874050.1| hypothetical protein ARALYDRAFT_910198 [Arab... 104 1e-20 >ref|XP_002299189.1| predicted protein [Populus trichocarpa] gi|222846447|gb|EEE83994.1| predicted protein [Populus trichocarpa] Length = 342 Score = 108 bits (269), Expect = 7e-22 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = +2 Query: 365 IIYGEWQDTHMEVRYTDVDYLVFSDAASLVVSGMSPYKRLTYRYSPLIAYLLTPNSII 538 I+YGEWQDTHMEVRYTDVDYLVFSDAASL+ +G SPYKR TYRYSPL+A+LLTPNS I Sbjct: 21 IVYGEWQDTHMEVRYTDVDYLVFSDAASLMANGESPYKRTTYRYSPLLAFLLTPNSFI 78 >ref|XP_002280567.1| PREDICTED: GPI mannosyltransferase 1 [Vitis vinifera] Length = 438 Score = 107 bits (266), Expect = 1e-21 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +2 Query: 365 IIYGEWQDTHMEVRYTDVDYLVFSDAASLVVSGMSPYKRLTYRYSPLIAYLLTPNSII 538 IIYGEWQD HMEVRYTDVDYLVFSDAASLV SG SPY+R TYRYSPL+A+LL PNSII Sbjct: 18 IIYGEWQDAHMEVRYTDVDYLVFSDAASLVASGKSPYQRSTYRYSPLLAFLLVPNSII 75 >ref|XP_002529987.1| conserved hypothetical protein [Ricinus communis] gi|223530510|gb|EEF32392.1| conserved hypothetical protein [Ricinus communis] Length = 265 Score = 106 bits (265), Expect = 2e-21 Identities = 50/58 (86%), Positives = 53/58 (91%) Frame = +2 Query: 365 IIYGEWQDTHMEVRYTDVDYLVFSDAASLVVSGMSPYKRLTYRYSPLIAYLLTPNSII 538 IIYGEWQD HMEVRYTDVDYLVFSDAASL+ SG SPYKR TYRYSPL+A+LL PNSII Sbjct: 21 IIYGEWQDAHMEVRYTDVDYLVFSDAASLMASGESPYKRSTYRYSPLLAFLLIPNSII 78 >gb|AFK35780.1| unknown [Lotus japonicus] Length = 299 Score = 104 bits (259), Expect = 1e-20 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = +2 Query: 365 IIYGEWQDTHMEVRYTDVDYLVFSDAASLVVSGMSPYKRLTYRYSPLIAYLLTPNSII 538 I+YGEWQD HMEVRYTDVDYLVFSDAASL+ SG SPYKR TYRYSPL+A+LL PNS + Sbjct: 21 IVYGEWQDAHMEVRYTDVDYLVFSDAASLMASGDSPYKRTTYRYSPLLAFLLIPNSFV 78 >ref|XP_002874050.1| hypothetical protein ARALYDRAFT_910198 [Arabidopsis lyrata subsp. lyrata] gi|297319887|gb|EFH50309.1| hypothetical protein ARALYDRAFT_910198 [Arabidopsis lyrata subsp. lyrata] Length = 450 Score = 104 bits (259), Expect = 1e-20 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +2 Query: 365 IIYGEWQDTHMEVRYTDVDYLVFSDAASLVVSGMSPYKRLTYRYSPLIAYLLTPNS 532 I+YGEWQD HMEVRYTDVDY+VFSDAASL+ SG SPYKR TYRYSPL+A LLTPNS Sbjct: 33 IVYGEWQDAHMEVRYTDVDYIVFSDAASLIASGESPYKRTTYRYSPLLALLLTPNS 88