BLASTX nr result
ID: Panax21_contig00015065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00015065 (1724 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535144.1| dicer-1, putative [Ricinus communis] gi|2235... 77 2e-11 ref|XP_002301611.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-10 ref|XP_003601360.1| Endoribonuclease Dicer-like protein [Medicag... 72 6e-10 ref|XP_002270948.2| PREDICTED: ribonuclease 3-like protein 3-lik... 72 6e-10 ref|XP_003601369.1| Endoribonuclease Dicer-like protein [Medicag... 71 1e-09 >ref|XP_002535144.1| dicer-1, putative [Ricinus communis] gi|223523936|gb|EEF27239.1| dicer-1, putative [Ricinus communis] Length = 259 Score = 76.6 bits (187), Expect = 2e-11 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +3 Query: 1224 QVRGFLSALPQYPLHSHGLIDPPKVLADIVESTIGAVFIDSNSSIDITWE 1373 Q+R F A+ +YPLHS+GL+D PKVLADIVES IGAVFIDSNSS+D W+ Sbjct: 132 QIREFSQAILEYPLHSNGLVDVPKVLADIVESAIGAVFIDSNSSVDTVWK 181 >ref|XP_002301611.1| predicted protein [Populus trichocarpa] gi|222843337|gb|EEE80884.1| predicted protein [Populus trichocarpa] Length = 303 Score = 73.9 bits (180), Expect = 1e-10 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 1224 QVRGFLSALPQYPLHSHGLIDPPKVLADIVESTIGAVFIDSNSSIDITWEVY 1379 Q+R F A+ YPLHS+GL++ PK LADIVE+ IGAVFIDSN SID+ W+++ Sbjct: 154 QIREFSQAILDYPLHSNGLVETPKALADIVEAAIGAVFIDSNFSIDVVWKIF 205 >ref|XP_003601360.1| Endoribonuclease Dicer-like protein [Medicago truncatula] gi|355490408|gb|AES71611.1| Endoribonuclease Dicer-like protein [Medicago truncatula] Length = 783 Score = 71.6 bits (174), Expect = 6e-10 Identities = 33/63 (52%), Positives = 46/63 (73%) Frame = +3 Query: 1224 QVRGFLSALPQYPLHSHGLIDPPKVLADIVESTIGAVFIDSNSSIDITWEVYSIFSILYF 1403 +++ F+ + +YPLHS+GLID PK+LADIVESTIGA+F+D SSI+ W+ F L Sbjct: 545 EIQAFIKEVVEYPLHSNGLIDVPKILADIVESTIGAIFVDCGSSIETVWK---FFKKLLV 601 Query: 1404 PVL 1412 PV+ Sbjct: 602 PVI 604 >ref|XP_002270948.2| PREDICTED: ribonuclease 3-like protein 3-like [Vitis vinifera] gi|297739192|emb|CBI28843.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 71.6 bits (174), Expect = 6e-10 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = +3 Query: 1224 QVRGFLSALPQYPLHSHGLIDPPKVLADIVESTIGAVFIDSNSSIDITWEVY 1379 Q+ F A+ +YPLHS+G I+ PKVLAD+VESTIGAVF+D N S+D W+V+ Sbjct: 130 QIYEFAEAIKEYPLHSNGQIEVPKVLADVVESTIGAVFVDCNCSVDTVWKVF 181 >ref|XP_003601369.1| Endoribonuclease Dicer-like protein [Medicago truncatula] gi|355490417|gb|AES71620.1| Endoribonuclease Dicer-like protein [Medicago truncatula] Length = 565 Score = 70.9 bits (172), Expect = 1e-09 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +3 Query: 1224 QVRGFLSALPQYPLHSHGLIDPPKVLADIVESTIGAVFIDSNSSIDITWEVY 1379 Q++ F + +YPLHS+GLID PK LADIVESTIGA+F+D SS++ W+V+ Sbjct: 328 QIQEFTKGIAEYPLHSNGLIDVPKSLADIVESTIGAIFVDCGSSVETVWKVF 379