BLASTX nr result
ID: Panax21_contig00014872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014872 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533502.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|2... 100 3e-19 ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250... 98 8e-19 ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|2... 97 2e-18 emb|CAN71484.1| hypothetical protein VITISV_025338 [Vitis vinifera] 96 3e-18 >ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis] gi|223526646|gb|EEF28889.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 100 bits (249), Expect = 2e-19 Identities = 46/81 (56%), Positives = 61/81 (75%) Frame = -2 Query: 243 VIDLTYCFLLFLFAFRRTSQNRLRILPRVFVGRSENLKQIVKVMSDAARRSLKSRGLHIP 64 +IDL + + + +++ LPRVFVG+SENLK+I+KVMSDAA+RSLK+R L +P Sbjct: 168 IIDLDFASQFEIARPTNEYRKQVQSLPRVFVGKSENLKRIIKVMSDAAKRSLKTRDLSLP 227 Query: 63 PWRKNRFIQNKWFGPYRRTVN 1 PWRKNR++QNKW GPY RT N Sbjct: 228 PWRKNRYMQNKWLGPYHRTCN 248 >ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|222850077|gb|EEE87624.1| predicted protein [Populus trichocarpa] Length = 289 Score = 99.8 bits (247), Expect = 3e-19 Identities = 51/84 (60%), Positives = 63/84 (75%), Gaps = 3/84 (3%) Frame = -2 Query: 243 VIDLTYCFLLFLFAFRRTSQNRLRI---LPRVFVGRSENLKQIVKVMSDAARRSLKSRGL 73 V+DL + F R + L++ LPRVFVGRSE+LK IVK +SDA++RSLKSR L Sbjct: 177 VVDLDFASQ---FEIARPTSQFLKLQHSLPRVFVGRSEDLKTIVKSISDASKRSLKSREL 233 Query: 72 HIPPWRKNRFIQNKWFGPYRRTVN 1 +PPWRKNR++QNKWFGPYRRTVN Sbjct: 234 SLPPWRKNRYMQNKWFGPYRRTVN 257 >ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250319 [Vitis vinifera] gi|296090565|emb|CBI40915.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 98.2 bits (243), Expect = 8e-19 Identities = 42/57 (73%), Positives = 53/57 (92%) Frame = -2 Query: 177 LRILPRVFVGRSENLKQIVKVMSDAARRSLKSRGLHIPPWRKNRFIQNKWFGPYRRT 7 ++ LPRVF+G+SE+LK+IVK+ DAA+RSLKSRGLH+PPWRKNR++QNKWFGP RRT Sbjct: 190 IQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQNKWFGPCRRT 246 >ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|222848523|gb|EEE86070.1| predicted protein [Populus trichocarpa] Length = 289 Score = 96.7 bits (239), Expect = 2e-18 Identities = 48/68 (70%), Positives = 56/68 (82%), Gaps = 2/68 (2%) Frame = -2 Query: 198 RRTSQ--NRLRILPRVFVGRSENLKQIVKVMSDAARRSLKSRGLHIPPWRKNRFIQNKWF 25 R TSQ L LPRVFVG+SE+LK IV+ +SDAA+RSLKSR L +PPWRKNR++QNKWF Sbjct: 187 RPTSQYLKLLHHLPRVFVGKSEDLKTIVRSISDAAKRSLKSRELSLPPWRKNRYMQNKWF 246 Query: 24 GPYRRTVN 1 GPY RTVN Sbjct: 247 GPYLRTVN 254 >emb|CAN71484.1| hypothetical protein VITISV_025338 [Vitis vinifera] Length = 282 Score = 96.3 bits (238), Expect = 3e-18 Identities = 41/56 (73%), Positives = 52/56 (92%) Frame = -2 Query: 177 LRILPRVFVGRSENLKQIVKVMSDAARRSLKSRGLHIPPWRKNRFIQNKWFGPYRR 10 ++ LPRVF+G+SE+LK+IVK+ DAA+RSLKSRGLH+PPWRKNR++QNKWFGP RR Sbjct: 190 IQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQNKWFGPCRR 245