BLASTX nr result
ID: Panax21_contig00014662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014662 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280716.1| PREDICTED: probable salt tolerance-like prot... 59 5e-07 >ref|XP_002280716.1| PREDICTED: probable salt tolerance-like protein At1g75540 [Vitis vinifera] gi|302142591|emb|CBI19794.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = +1 Query: 16 LGGQICFKNPKETTTNIKPSRKWRDDGGFTVPQISPLSIASKRSRTFW 159 +GGQI K KE TT S+KW DD FTVPQISP S+ SKRSR+FW Sbjct: 253 MGGQIGLKESKEATTMKPNSKKWGDDV-FTVPQISPPSVGSKRSRSFW 299