BLASTX nr result
ID: Panax21_contig00014591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014591 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612164.1| Transcription-associated protein [Medicago t... 69 5e-10 ref|XP_003537633.1| PREDICTED: transformation/transcription doma... 67 1e-09 ref|XP_003517177.1| PREDICTED: transformation/transcription doma... 67 1e-09 ref|NP_179383.3| transformation/transcription domain-associated ... 67 1e-09 ref|XP_002521662.1| inositol or phosphatidylinositol kinase, put... 67 1e-09 >ref|XP_003612164.1| Transcription-associated protein [Medicago truncatula] gi|355513499|gb|AES95122.1| Transcription-associated protein [Medicago truncatula] Length = 3990 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +3 Query: 99 WN*VHMVEDDLMYNTFLDVYENHFSWNDREADLPITYF 212 W+ V MVEDDLMY+TFL+VYENH S NDREADLPITYF Sbjct: 3696 WSQVRMVEDDLMYSTFLEVYENHCSRNDREADLPITYF 3733 >ref|XP_003537633.1| PREDICTED: transformation/transcription domain-associated protein-like [Glycine max] Length = 3866 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 99 WN*VHMVEDDLMYNTFLDVYENHFSWNDREADLPITYF 212 W+ V MVEDDLMY+TFL+VYENH + NDREADLPITYF Sbjct: 3572 WSQVRMVEDDLMYSTFLEVYENHCARNDREADLPITYF 3609 >ref|XP_003517177.1| PREDICTED: transformation/transcription domain-associated protein-like [Glycine max] Length = 3865 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 99 WN*VHMVEDDLMYNTFLDVYENHFSWNDREADLPITYF 212 W+ V MVEDDLMY+TFL+VYENH + NDREADLPITYF Sbjct: 3571 WSQVRMVEDDLMYSTFLEVYENHCARNDREADLPITYF 3608 >ref|NP_179383.3| transformation/transcription domain-associated protein [Arabidopsis thaliana] gi|330251608|gb|AEC06702.1| transformation/transcription domain-associated protein [Arabidopsis thaliana] Length = 3858 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 99 WN*VHMVEDDLMYNTFLDVYENHFSWNDREADLPITYF 212 W+ V MVEDDLMYNTFL+VYENH + NDREADLPIT+F Sbjct: 3563 WSQVRMVEDDLMYNTFLEVYENHCARNDREADLPITHF 3600 >ref|XP_002521662.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] gi|223539053|gb|EEF40649.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] Length = 3772 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 99 WN*VHMVEDDLMYNTFLDVYENHFSWNDREADLPITYF 212 W+ V MVEDDLMY+TFL+VYENH + NDREADLPITYF Sbjct: 3477 WSQVRMVEDDLMYSTFLEVYENHCARNDREADLPITYF 3514