BLASTX nr result
ID: Panax21_contig00014414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014414 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595227.1| Calmodulin-binding protein [Medicago truncat... 61 1e-07 gb|AFK41841.1| unknown [Lotus japonicus] 59 3e-07 ref|XP_002279373.1| PREDICTED: uncharacterized protein LOC100256... 59 4e-07 emb|CAN80416.1| hypothetical protein VITISV_024541 [Vitis vinifera] 59 4e-07 ref|XP_003549227.1| PREDICTED: uncharacterized protein LOC100776... 59 5e-07 >ref|XP_003595227.1| Calmodulin-binding protein [Medicago truncatula] gi|355484275|gb|AES65478.1| Calmodulin-binding protein [Medicago truncatula] Length = 508 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 1 PSPRPSPKVRLSPRLSYMGLPSPRTPIP 84 PSPRPSPKVR+SPRL+YMGLPSPRTPIP Sbjct: 480 PSPRPSPKVRISPRLAYMGLPSPRTPIP 507 >gb|AFK41841.1| unknown [Lotus japonicus] Length = 97 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 PSPRPSPKVRLSPRLSYMGLPSPRTPIPS 87 PSPRPSPKVR+SPRL+YMGLPSPR PIP+ Sbjct: 67 PSPRPSPKVRMSPRLAYMGLPSPRNPIPA 95 >ref|XP_002279373.1| PREDICTED: uncharacterized protein LOC100256072 [Vitis vinifera] gi|297738645|emb|CBI27890.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 PSPRPSPKVRLSPRLSYMGLPSPRTPIPSN 90 PSPRPSPK+RLSPRL+YMGLPSPRTPI ++ Sbjct: 505 PSPRPSPKIRLSPRLAYMGLPSPRTPIAAS 534 >emb|CAN80416.1| hypothetical protein VITISV_024541 [Vitis vinifera] Length = 544 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 PSPRPSPKVRLSPRLSYMGLPSPRTPIPSN 90 PSPRPSPK+RLSPRL+YMGLPSPRTPI ++ Sbjct: 514 PSPRPSPKIRLSPRLAYMGLPSPRTPIAAS 543 >ref|XP_003549227.1| PREDICTED: uncharacterized protein LOC100776993 [Glycine max] Length = 530 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 1 PSPRPSPKVRLSPRLSYMGLPSPRTPIPS 87 PSPRPSPKVR+SPR++YMGLPSPR PIP+ Sbjct: 500 PSPRPSPKVRMSPRIAYMGLPSPRNPIPA 528