BLASTX nr result
ID: Panax21_contig00014178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014178 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|22... 66 3e-09 ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein lig... 64 2e-08 ref|NP_001064306.1| Os10g0204100 [Oryza sativa Japonica Group] g... 64 2e-08 tpg|DAA44438.1| TPA: putative RING zinc finger domain superfamil... 64 2e-08 >ref|XP_002519543.1| mahogunin, putative [Ricinus communis] gi|223541406|gb|EEF42957.1| mahogunin, putative [Ricinus communis] Length = 306 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 388 CAKVLRFQTNRCPICRQPVERLLEIKVNNG 299 CAKVLR+QTNRCPICRQPVERLLEIKVNNG Sbjct: 274 CAKVLRYQTNRCPICRQPVERLLEIKVNNG 303 >ref|XP_002326350.1| predicted protein [Populus trichocarpa] gi|222833543|gb|EEE72020.1| predicted protein [Populus trichocarpa] Length = 284 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 388 CAKVLRFQTNRCPICRQPVERLLEIKVNNG 299 CAKVLRFQTNRCPICRQPV+RLLEIKVNNG Sbjct: 252 CAKVLRFQTNRCPICRQPVDRLLEIKVNNG 281 >ref|XP_004137817.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] gi|449513666|ref|XP_004164388.1| PREDICTED: probable E3 ubiquitin-protein ligase LOG2-like [Cucumis sativus] Length = 368 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 388 CAKVLRFQTNRCPICRQPVERLLEIKVNNGTKD 290 CAKVLRFQTNRCPICRQPV+RLLEI+V+NG ++ Sbjct: 335 CAKVLRFQTNRCPICRQPVDRLLEIRVSNGPEE 367 >ref|NP_001064306.1| Os10g0204100 [Oryza sativa Japonica Group] gi|19225030|gb|AAL86506.1|AC099040_10 putative hydroxyproline-rich glycoprotein [Oryza sativa Japonica Group] gi|20279471|gb|AAM18751.1|AC099325_7 unknown protein [Oryza sativa Japonica Group] gi|31430853|gb|AAP52712.1| RING zinc finger protein, putative, expressed [Oryza sativa Japonica Group] gi|113638915|dbj|BAF26220.1| Os10g0204100 [Oryza sativa Japonica Group] gi|222612586|gb|EEE50718.1| hypothetical protein OsJ_31005 [Oryza sativa Japonica Group] Length = 425 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 388 CAKVLRFQTNRCPICRQPVERLLEIKVNN 302 CAKVLR+QTNRCPICRQPVERLLEIKVNN Sbjct: 367 CAKVLRYQTNRCPICRQPVERLLEIKVNN 395 >tpg|DAA44438.1| TPA: putative RING zinc finger domain superfamily protein isoform 1 [Zea mays] gi|414865882|tpg|DAA44439.1| TPA: putative RING zinc finger domain superfamily protein isoform 2 [Zea mays] Length = 400 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 388 CAKVLRFQTNRCPICRQPVERLLEIKVNNGTKD 290 CAKVLR+QT RCPICRQPVERLLEIKVNN ++D Sbjct: 348 CAKVLRYQTTRCPICRQPVERLLEIKVNNKSED 380