BLASTX nr result
ID: Panax21_contig00014123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00014123 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517095.1| ATP-dependent RNA and DNA helicase, putative... 65 8e-09 ref|XP_003537614.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 59 4e-07 ref|XP_003516752.1| PREDICTED: ATP-dependent RNA helicase SUPV3L... 58 9e-07 ref|XP_002315757.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003610757.1| ATP-dependent RNA helicase SUPV3L1 [Medicago... 55 8e-06 >ref|XP_002517095.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] gi|223543730|gb|EEF45258.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] Length = 547 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 379 SFPDRELASSQKDICSLLIEQFLERLGWQKPRPPK 275 SFPDRELA+SQK ICSLLIE+FLERLGWQKPR K Sbjct: 494 SFPDRELAASQKAICSLLIEEFLERLGWQKPRTTK 528 >ref|XP_003537614.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Length = 565 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 379 SFPDRELASSQKDICSLLIEQFLERLGWQKP 287 SFPD ELA+SQK ICS+LIE+FLERLGWQKP Sbjct: 512 SFPDHELAASQKAICSMLIEEFLERLGWQKP 542 >ref|XP_003516752.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Length = 600 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 379 SFPDRELASSQKDICSLLIEQFLERLGWQKP 287 SFPD ELA SQK ICS+LIE+FLERLGWQKP Sbjct: 547 SFPDHELAVSQKAICSMLIEEFLERLGWQKP 577 >ref|XP_002315757.1| predicted protein [Populus trichocarpa] gi|222864797|gb|EEF01928.1| predicted protein [Populus trichocarpa] Length = 571 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 379 SFPDRELASSQKDICSLLIEQFLERLGWQK 290 SFPDRELA+SQK IC LLIE+FLER GWQK Sbjct: 517 SFPDRELAASQKAICGLLIEEFLERFGWQK 546 >ref|XP_003610757.1| ATP-dependent RNA helicase SUPV3L1 [Medicago truncatula] gi|355512092|gb|AES93715.1| ATP-dependent RNA helicase SUPV3L1 [Medicago truncatula] Length = 570 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 379 SFPDRELASSQKDICSLLIEQFLERLGWQKP 287 SFPD ELA SQK +CS+LIE+FL+R GWQKP Sbjct: 517 SFPDHELAKSQKALCSMLIEEFLDRYGWQKP 547