BLASTX nr result
ID: Panax21_contig00013902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013902 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138291.1| PREDICTED: microtubule-associated protein TO... 57 2e-06 emb|CBI15107.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002280600.1| PREDICTED: microtubule-associated protein TO... 56 3e-06 >ref|XP_004138291.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] gi|449477623|ref|XP_004155074.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Cucumis sativus] Length = 628 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 5/71 (7%) Frame = -1 Query: 198 SILVHLESCLTNL---FRFYPFLFDSCCMDYKTPLH--ITKPPFTSIAKPLIDALVTEQD 34 S+ +L L+N+ FR S C+ T L +TKPPF++ KPL D+L TEQD Sbjct: 83 SLAPYLSKILSNITRRFRDPDSSVRSACVSSVTALASGVTKPPFSTFLKPLTDSLFTEQD 142 Query: 33 MNSQIGAALCL 1 NSQ+GAALCL Sbjct: 143 SNSQVGAALCL 153 >emb|CBI15107.3| unnamed protein product [Vitis vinifera] Length = 521 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 102 HITKPPFTSIAKPLIDALVTEQDMNSQIGAALCL 1 HITKPPF+SI KPL + L TEQD N+QIGA+LCL Sbjct: 4 HITKPPFSSIVKPLAETLFTEQDHNAQIGASLCL 37 >ref|XP_002280600.1| PREDICTED: microtubule-associated protein TORTIFOLIA1-like [Vitis vinifera] Length = 638 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 102 HITKPPFTSIAKPLIDALVTEQDMNSQIGAALCL 1 HITKPPF+SI KPL + L TEQD N+QIGA+LCL Sbjct: 121 HITKPPFSSIVKPLAETLFTEQDHNAQIGASLCL 154