BLASTX nr result
ID: Panax21_contig00013650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013650 (469 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515987.1| Cell division protein ftsH, putative [Ricinu... 76 5e-20 ref|XP_002303302.1| predicted protein [Populus trichocarpa] gi|2... 77 7e-20 ref|XP_002964519.1| hypothetical protein SELMODRAFT_166773 [Sela... 53 2e-13 ref|XP_002993142.1| hypothetical protein SELMODRAFT_236685 [Sela... 53 2e-13 ref|XP_001764083.1| predicted protein [Physcomitrella patens sub... 57 1e-12 >ref|XP_002515987.1| Cell division protein ftsH, putative [Ricinus communis] gi|223544892|gb|EEF46407.1| Cell division protein ftsH, putative [Ricinus communis] Length = 884 Score = 76.3 bits (186), Expect(2) = 5e-20 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 132 YMDVASMTDGMVGAELANIIKVAAINMMLDGRTEITIDDLLQAA 1 YM VASMTDGMVGAELANII+VAAINMM DGRTE+T DDLLQAA Sbjct: 613 YMAVASMTDGMVGAELANIIEVAAINMMRDGRTEMTTDDLLQAA 656 Score = 46.2 bits (108), Expect(2) = 5e-20 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -1 Query: 211 NRLDILDPALVRPGRFDIKIYIRKLSLYG 125 NR DILDPALVRPGRFD KIYI K L G Sbjct: 565 NRPDILDPALVRPGRFDRKIYIPKPGLIG 593 >ref|XP_002303302.1| predicted protein [Populus trichocarpa] gi|222840734|gb|EEE78281.1| predicted protein [Populus trichocarpa] Length = 844 Score = 77.4 bits (189), Expect(2) = 7e-20 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -2 Query: 132 YMDVASMTDGMVGAELANIIKVAAINMMLDGRTEITIDDLLQAA 1 YM VASMTDGMVGAELANII+VAAINMM DGRTEIT DDLLQAA Sbjct: 577 YMAVASMTDGMVGAELANIIEVAAINMMRDGRTEITTDDLLQAA 620 Score = 44.7 bits (104), Expect(2) = 7e-20 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -1 Query: 211 NRLDILDPALVRPGRFDIKIYIRKLSLYG 125 NR DILDPALVRPGRFD KI+I K L G Sbjct: 529 NRPDILDPALVRPGRFDRKIFIPKPGLIG 557 >ref|XP_002964519.1| hypothetical protein SELMODRAFT_166773 [Selaginella moellendorffii] gi|300168248|gb|EFJ34852.1| hypothetical protein SELMODRAFT_166773 [Selaginella moellendorffii] Length = 804 Score = 52.8 bits (125), Expect(2) = 2e-13 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -2 Query: 132 YMDVASMTDGMVGAELANIIKVAAINMMLDGRTEITIDDLLQAA 1 Y V +T GM GA+LA+I+ VAA+ + DGRTE+T DDLL+AA Sbjct: 531 YRAVGQITAGMAGAQLAHIVDVAALAALRDGRTEVTTDDLLEAA 574 Score = 47.8 bits (112), Expect(2) = 2e-13 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 211 NRLDILDPALVRPGRFDIKIYIRKLSLYG 125 NR DILDPALVRPGRFD KIYI K SL G Sbjct: 483 NRPDILDPALVRPGRFDRKIYIPKPSLQG 511 >ref|XP_002993142.1| hypothetical protein SELMODRAFT_236685 [Selaginella moellendorffii] gi|300139033|gb|EFJ05782.1| hypothetical protein SELMODRAFT_236685 [Selaginella moellendorffii] Length = 772 Score = 52.8 bits (125), Expect(2) = 2e-13 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -2 Query: 132 YMDVASMTDGMVGAELANIIKVAAINMMLDGRTEITIDDLLQAA 1 Y V +T GM GA+LA+I+ VAA+ + DGRTE+T DDLL+AA Sbjct: 514 YRAVGQITAGMAGAQLAHIVDVAALAALRDGRTEVTTDDLLEAA 557 Score = 47.8 bits (112), Expect(2) = 2e-13 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -1 Query: 211 NRLDILDPALVRPGRFDIKIYIRKLSLYG 125 NR DILDPALVRPGRFD KIYI K SL G Sbjct: 466 NRPDILDPALVRPGRFDRKIYIPKPSLQG 494 >ref|XP_001764083.1| predicted protein [Physcomitrella patens subsp. patens] gi|162684822|gb|EDQ71222.1| predicted protein [Physcomitrella patens subsp. patens] Length = 802 Score = 57.0 bits (136), Expect(2) = 1e-12 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 132 YMDVASMTDGMVGAELANIIKVAAINMMLDGRTEITIDDLLQAA 1 Y VA MTDGMVGA+LANI+ VAA+ ++ + R+EIT DDLL+AA Sbjct: 530 YDAVAEMTDGMVGAQLANILDVAALQVLRERRSEITTDDLLEAA 573 Score = 40.8 bits (94), Expect(2) = 1e-12 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 211 NRLDILDPALVRPGRFDIKIYIRK 140 NR DILD ALVRPGRFD KIYI K Sbjct: 482 NRPDILDTALVRPGRFDRKIYIPK 505