BLASTX nr result
ID: Panax21_contig00013501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013501 (603 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 56 4e-06 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 603 WRKASRQYSRERYNSISLKLMQDGSFQVPN 514 WRKASRQYSRERYNS+SLKLM+DGS Q+ N Sbjct: 498 WRKASRQYSRERYNSLSLKLMKDGSLQMSN 527