BLASTX nr result
ID: Panax21_contig00013439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013439 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330104.1| predicted protein [Populus trichocarpa] gi|2... 101 6e-20 emb|CBI15184.3| unnamed protein product [Vitis vinifera] 101 7e-20 ref|XP_004138306.1| PREDICTED: formin-like protein 20-like [Cucu... 100 1e-19 ref|XP_002514716.1| conserved hypothetical protein [Ricinus comm... 100 1e-19 ref|XP_002281720.2| PREDICTED: formin-like protein 6-like [Vitis... 100 1e-19 >ref|XP_002330104.1| predicted protein [Populus trichocarpa] gi|222871238|gb|EEF08369.1| predicted protein [Populus trichocarpa] Length = 464 Score = 101 bits (252), Expect = 6e-20 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 177 APRRSTLKPLHWSKVTRALQGSLWEELQRQGDPQSPPEFDVSEIESLFSATVPK 16 APRRS+LKPLHWSKVTRA+QGSLWEELQR G+PQ PEFDVSE+ESLFSATVPK Sbjct: 56 APRRSSLKPLHWSKVTRAIQGSLWEELQRHGEPQIAPEFDVSELESLFSATVPK 109 >emb|CBI15184.3| unnamed protein product [Vitis vinifera] Length = 1010 Score = 101 bits (251), Expect = 7e-20 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -3 Query: 186 PVQAPRRSTLKPLHWSKVTRALQGSLWEELQRQGDPQSPPEFDVSEIESLFSATVPKS 13 P APRRS+LKPLHWSKVTRALQGSLWEELQR G+PQ PEFDVSE+E+LFSATVP S Sbjct: 597 PPFAPRRSSLKPLHWSKVTRALQGSLWEELQRYGEPQIAPEFDVSELETLFSATVPNS 654 >ref|XP_004138306.1| PREDICTED: formin-like protein 20-like [Cucumis sativus] Length = 1275 Score = 100 bits (250), Expect = 1e-19 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = -3 Query: 177 APRRSTLKPLHWSKVTRALQGSLWEELQRQGDPQSPPEFDVSEIESLFSATVPK 16 APRRS+LKPLHWSKVTRALQGSLWEELQR G+PQ PEFDVSE+E+LFSATVPK Sbjct: 869 APRRSSLKPLHWSKVTRALQGSLWEELQRYGEPQIAPEFDVSELETLFSATVPK 922 >ref|XP_002514716.1| conserved hypothetical protein [Ricinus communis] gi|223546320|gb|EEF47822.1| conserved hypothetical protein [Ricinus communis] Length = 1550 Score = 100 bits (250), Expect = 1e-19 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = -3 Query: 177 APRRSTLKPLHWSKVTRALQGSLWEELQRQGDPQSPPEFDVSEIESLFSATVPKSNRAG 1 APRRS+LKPLHWSKVTRA+QGSLWEELQR +PQ PEFDVSE+ESLFSATVPK+ +G Sbjct: 1141 APRRSSLKPLHWSKVTRAIQGSLWEELQRHAEPQIAPEFDVSELESLFSATVPKAADSG 1199 >ref|XP_002281720.2| PREDICTED: formin-like protein 6-like [Vitis vinifera] Length = 1498 Score = 100 bits (249), Expect = 1e-19 Identities = 47/55 (85%), Positives = 51/55 (92%) Frame = -3 Query: 177 APRRSTLKPLHWSKVTRALQGSLWEELQRQGDPQSPPEFDVSEIESLFSATVPKS 13 APRRS+LKPLHWSKVTRALQGSLWEELQR G+PQ PEFDVSE+E+LFSATVP S Sbjct: 1088 APRRSSLKPLHWSKVTRALQGSLWEELQRYGEPQIAPEFDVSELETLFSATVPNS 1142