BLASTX nr result
ID: Panax21_contig00013207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013207 (484 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540749.1| PREDICTED: pentatricopeptide repeat-containi... 147 7e-34 ref|XP_003606459.1| Pentatricopeptide repeat-containing protein ... 146 1e-33 ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containi... 145 3e-33 ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containi... 145 3e-33 ref|XP_002282154.2| PREDICTED: pentatricopeptide repeat-containi... 140 8e-32 >ref|XP_003540749.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Glycine max] Length = 438 Score = 147 bits (372), Expect = 7e-34 Identities = 72/103 (69%), Positives = 85/103 (82%) Frame = +3 Query: 174 GRAKNAKELCNQMKEKGFVPSSKSYNSLVNSLALGGAVDEAVKYLWEMIEKRRSADFITY 353 GR NAKEL ++MK KGFVPSSKSYNSLVNSLALGG ++EAV YLWEM +K+RSADFITY Sbjct: 304 GRTNNAKELYSEMKTKGFVPSSKSYNSLVNSLALGGEIEEAVNYLWEMTDKQRSADFITY 363 Query: 354 RTVLDEIWRHRRVEDGVILLKDLQEKDIVDFHTYKKLRYELED 482 +TVLDEI R V++G L++LQEKD+VD H Y+KL Y LED Sbjct: 364 KTVLDEICRRGTVQEGTRFLQELQEKDLVDGHAYRKLLYVLED 406 >ref|XP_003606459.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355507514|gb|AES88656.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 418 Score = 146 bits (369), Expect = 1e-33 Identities = 73/103 (70%), Positives = 86/103 (83%) Frame = +3 Query: 174 GRAKNAKELCNQMKEKGFVPSSKSYNSLVNSLALGGAVDEAVKYLWEMIEKRRSADFITY 353 GR +NAKEL ++MK KGFVPSSKSYNSLVNSLAL G V+EAV YLWEM EK++S DFITY Sbjct: 298 GRTENAKELYHEMKAKGFVPSSKSYNSLVNSLALVGDVEEAVNYLWEMTEKQKSVDFITY 357 Query: 354 RTVLDEIWRHRRVEDGVILLKDLQEKDIVDFHTYKKLRYELED 482 RTVLDEI R RV++ + L++LQEKD+VD HTY+KL Y LED Sbjct: 358 RTVLDEICRRGRVQEAMRFLQELQEKDLVDGHTYRKLLYVLED 400 >ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 145 bits (367), Expect = 3e-33 Identities = 70/102 (68%), Positives = 84/102 (82%) Frame = +3 Query: 177 RAKNAKELCNQMKEKGFVPSSKSYNSLVNSLALGGAVDEAVKYLWEMIEKRRSADFITYR 356 R NAKELCN+MKEKGFVPSS SYNS+VN+LAL G V++AV YLWEMI+ RRS DFITY+ Sbjct: 321 RTDNAKELCNEMKEKGFVPSSISYNSIVNALALNGEVEDAVNYLWEMIDNRRSPDFITYK 380 Query: 357 TVLDEIWRHRRVEDGVILLKDLQEKDIVDFHTYKKLRYELED 482 TVLDE+ R +V + LL++LQEKD+VD HTY+KL Y LED Sbjct: 381 TVLDELCRQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLED 422 >ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 145 bits (367), Expect = 3e-33 Identities = 70/102 (68%), Positives = 84/102 (82%) Frame = +3 Query: 177 RAKNAKELCNQMKEKGFVPSSKSYNSLVNSLALGGAVDEAVKYLWEMIEKRRSADFITYR 356 R NAKELCN+MKEKGFVPSS SYNS+VN+LAL G V++AV YLWEMI+ RRS DFITY+ Sbjct: 321 RTDNAKELCNEMKEKGFVPSSISYNSIVNALALNGEVEDAVNYLWEMIDNRRSPDFITYK 380 Query: 357 TVLDEIWRHRRVEDGVILLKDLQEKDIVDFHTYKKLRYELED 482 TVLDE+ R +V + LL++LQEKD+VD HTY+KL Y LED Sbjct: 381 TVLDELCRQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLED 422 >ref|XP_002282154.2| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Vitis vinifera] Length = 356 Score = 140 bits (354), Expect = 8e-32 Identities = 70/101 (69%), Positives = 83/101 (82%) Frame = +3 Query: 177 RAKNAKELCNQMKEKGFVPSSKSYNSLVNSLALGGAVDEAVKYLWEMIEKRRSADFITYR 356 R NA++LCN+MK KGFVPSSKSYNSLVN+LAL G VDEAV YLWEM EK+RSADFITY+ Sbjct: 242 RTNNARKLCNEMKGKGFVPSSKSYNSLVNALALCGEVDEAVNYLWEMTEKQRSADFITYQ 301 Query: 357 TVLDEIWRHRRVEDGVILLKDLQEKDIVDFHTYKKLRYELE 479 TVLD+I R R +D + LLK+LQ KD++D HTY+KL LE Sbjct: 302 TVLDQICRQGRTQDAMSLLKELQVKDLLDGHTYQKLLSLLE 342