BLASTX nr result
ID: Panax21_contig00011456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00011456 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC16734.1| arabinogalactan protein [Daucus carota] 108 6e-22 ref|XP_002274293.2| PREDICTED: pistil-specific extensin-like pro... 101 5e-20 emb|CBI29537.3| unnamed protein product [Vitis vinifera] 101 5e-20 gb|ABG91751.1| HyPRP1 [Gossypium hirsutum] 97 1e-18 ref|XP_002305791.1| predicted protein [Populus trichocarpa] gi|2... 91 7e-17 >emb|CAC16734.1| arabinogalactan protein [Daucus carota] Length = 242 Score = 108 bits (269), Expect = 6e-22 Identities = 49/81 (60%), Positives = 62/81 (76%), Gaps = 1/81 (1%) Frame = +1 Query: 1 NGYFFISAPKTLTNYGSHKCKVSIVSSPLATCNKPTNLHYGLLGAFLMPLNKPPISTH-P 177 NGYF ++APKT+T YG HKC+V +VSSP C+KPTNL YG+ GA L KPP+ST P Sbjct: 160 NGYFSLNAPKTITTYGVHKCRVFVVSSPEKKCDKPTNLRYGVKGAILEKSTKPPVSTKTP 219 Query: 178 IGFDLFNVGPFAFEPSSKEQC 240 F++F+VGPFAFEPS+K+ C Sbjct: 220 ATFEMFSVGPFAFEPSTKKPC 240 >ref|XP_002274293.2| PREDICTED: pistil-specific extensin-like protein-like [Vitis vinifera] Length = 187 Score = 101 bits (252), Expect = 5e-20 Identities = 47/82 (57%), Positives = 58/82 (70%) Frame = +1 Query: 1 NGYFFISAPKTLTNYGSHKCKVSIVSSPLATCNKPTNLHYGLLGAFLMPLNKPPISTHPI 180 NGYFFI APK +T +G+HKCKVS++SS TCN T+LH+GL GA L P KPP P Sbjct: 107 NGYFFIQAPKKITTFGAHKCKVSLISSSSPTCNLATDLHFGLKGAILRP-EKPPAGLPPP 165 Query: 181 GFDLFNVGPFAFEPSSKEQCQR 246 + F+VGPFAFEP+ K +C R Sbjct: 166 PYVTFSVGPFAFEPAKKVECPR 187 >emb|CBI29537.3| unnamed protein product [Vitis vinifera] Length = 159 Score = 101 bits (252), Expect = 5e-20 Identities = 47/82 (57%), Positives = 58/82 (70%) Frame = +1 Query: 1 NGYFFISAPKTLTNYGSHKCKVSIVSSPLATCNKPTNLHYGLLGAFLMPLNKPPISTHPI 180 NGYFFI APK +T +G+HKCKVS++SS TCN T+LH+GL GA L P KPP P Sbjct: 79 NGYFFIQAPKKITTFGAHKCKVSLISSSSPTCNLATDLHFGLKGAILRP-EKPPAGLPPP 137 Query: 181 GFDLFNVGPFAFEPSSKEQCQR 246 + F+VGPFAFEP+ K +C R Sbjct: 138 PYVTFSVGPFAFEPAKKVECPR 159 >gb|ABG91751.1| HyPRP1 [Gossypium hirsutum] Length = 326 Score = 97.1 bits (240), Expect = 1e-18 Identities = 44/74 (59%), Positives = 58/74 (78%) Frame = +1 Query: 1 NGYFFISAPKTLTNYGSHKCKVSIVSSPLATCNKPTNLHYGLLGAFLMPLNKPPISTHPI 180 NGYFF+ APKT+T++G+HKC VS+VSSP+A C+KP+NLH GL GA L P + P + + + Sbjct: 252 NGYFFLQAPKTVTSFGAHKCTVSLVSSPMAKCSKPSNLHGGLKGATLRP--EKPFTANKL 309 Query: 181 GFDLFNVGPFAFEP 222 F L+ VGPFAFEP Sbjct: 310 PFILYTVGPFAFEP 323 >ref|XP_002305791.1| predicted protein [Populus trichocarpa] gi|222848755|gb|EEE86302.1| predicted protein [Populus trichocarpa] Length = 151 Score = 91.3 bits (225), Expect = 7e-17 Identities = 44/73 (60%), Positives = 50/73 (68%) Frame = +1 Query: 1 NGYFFISAPKTLTNYGSHKCKVSIVSSPLATCNKPTNLHYGLLGAFLMPLNKPPISTHPI 180 NGYF I AP T+TNYG HKCKV +VS+P C+K TNLH GL GA L P KP + Sbjct: 74 NGYFLIKAPGTITNYGVHKCKVWLVSAPSTACSKITNLHGGLTGAMLRPEKKPFVDEKKR 133 Query: 181 GFDLFNVGPFAFE 219 F LF+VGPFAFE Sbjct: 134 EFALFSVGPFAFE 146