BLASTX nr result
ID: Panax21_contig00011429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00011429 (2060 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517345.1| peptidyl-prolyl cis-trans isomerase, putativ... 58 9e-06 >ref|XP_002517345.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223543356|gb|EEF44887.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 465 Score = 58.2 bits (139), Expect = 9e-06 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 3/53 (5%) Frame = +1 Query: 337 SLIISGLAESKKDYGIKLLDKLEVGILDELQKIVEDKXMNA---SSLDVLKYV 486 +LIISGLAESKKD+G++LLDKLE G +DELQ+IVED+ +A ++L YV Sbjct: 187 TLIISGLAESKKDHGVELLDKLEAG-MDELQQIVEDRNRDAVASKQKELLNYV 238