BLASTX nr result
ID: Panax21_contig00010626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00010626 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326379.1| predicted protein [Populus trichocarpa] gi|2... 89 4e-16 ref|XP_002519467.1| conserved hypothetical protein [Ricinus comm... 88 8e-16 ref|XP_003542552.1| PREDICTED: heparan-alpha-glucosaminide N-ace... 87 1e-15 ref|XP_003520659.1| PREDICTED: heparan-alpha-glucosaminide N-ace... 86 3e-15 ref|XP_002268831.2| PREDICTED: heparan-alpha-glucosaminide N-ace... 86 3e-15 >ref|XP_002326379.1| predicted protein [Populus trichocarpa] gi|222833572|gb|EEE72049.1| predicted protein [Populus trichocarpa] Length = 496 Score = 89.0 bits (219), Expect = 4e-16 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -3 Query: 134 VWGISHLYSGPVWSRLKACTFSSPSAGPLRKDAPSWCRAPFEPE 3 VWGI+HLY PVWSRLKACT SSP +GP RKDAPSWCRAPFEPE Sbjct: 273 VWGINHLYQYPVWSRLKACTLSSPGSGPFRKDAPSWCRAPFEPE 316 >ref|XP_002519467.1| conserved hypothetical protein [Ricinus communis] gi|223541330|gb|EEF42881.1| conserved hypothetical protein [Ricinus communis] Length = 519 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -3 Query: 134 VWGISHLYSGPVWSRLKACTFSSPSAGPLRKDAPSWCRAPFEPE 3 VWGI+HLY PVWSRLKACTFSSP+ GPLR DAPSWC APFEPE Sbjct: 296 VWGINHLYQYPVWSRLKACTFSSPATGPLRADAPSWCLAPFEPE 339 >ref|XP_003542552.1| PREDICTED: heparan-alpha-glucosaminide N-acetyltransferase-like [Glycine max] Length = 419 Score = 87.4 bits (215), Expect = 1e-15 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 134 VWGISHLYSGPVWSRLKACTFSSPSAGPLRKDAPSWCRAPFEPE 3 VWG++HLYS PVW+RLKACT SSP+ GPLRK+AP+WCRAPFEPE Sbjct: 196 VWGVNHLYSQPVWTRLKACTLSSPAEGPLRKNAPAWCRAPFEPE 239 >ref|XP_003520659.1| PREDICTED: heparan-alpha-glucosaminide N-acetyltransferase-like [Glycine max] Length = 508 Score = 85.9 bits (211), Expect = 3e-15 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -3 Query: 134 VWGISHLYSGPVWSRLKACTFSSPSAGPLRKDAPSWCRAPFEPE 3 VWG++HLYS PVW RLKACTFSSP +GP R DAPSWC APFEPE Sbjct: 285 VWGVNHLYSQPVWRRLKACTFSSPGSGPFRDDAPSWCLAPFEPE 328 >ref|XP_002268831.2| PREDICTED: heparan-alpha-glucosaminide N-acetyltransferase-like [Vitis vinifera] gi|297739972|emb|CBI30154.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 85.9 bits (211), Expect = 3e-15 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 134 VWGISHLYSGPVWSRLKACTFSSPSAGPLRKDAPSWCRAPFEPE 3 VWGI+HLYS PVW+RLKACT SSP++GP R+DAPSWC APFEPE Sbjct: 266 VWGINHLYSQPVWTRLKACTLSSPNSGPFREDAPSWCYAPFEPE 309