BLASTX nr result
ID: Panax21_contig00010564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00010564 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota] 57 1e-06 >dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota] Length = 619 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 514 PFNIGTADYSVDPMAMQDVSMWKGWGGSFD 425 PFN+GTADY+ DP++ Q+ SMWKGWGGSFD Sbjct: 587 PFNLGTADYTADPLSNQNGSMWKGWGGSFD 616